KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397860Help
Entry
100397860         CDS       T03264                                 

Gene name
ADRA1D
Definition
(RefSeq) adrenoceptor alpha 1D
  KO
K04137  adrenergic receptor alpha-1D
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100397860 (ADRA1D)
   04022 cGMP-PKG signaling pathway
    100397860 (ADRA1D)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100397860 (ADRA1D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100397860 (ADRA1D)
   04270 Vascular smooth muscle contraction
    100397860 (ADRA1D)
  09154 Digestive system
   04970 Salivary secretion
    100397860 (ADRA1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100397860 (ADRA1D)
G protein-coupled receptors [BR:cjc04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    100397860 (ADRA1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 100397860
NCBI-ProteinID: XP_002747369
Ensembl: ENSCJAG00000021251
UniProt: F7CTX8
LinkDB All DBs
Position
5
AA seq 571 aa AA seqDB search
MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGAAGGGGGGVVGA
GSGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVIL
SVACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLC
CTASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPV
PPDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKA
SEVVLRIHCRGAATGADGAHGTRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVL
CWFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRC
QCRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGAAPPGAPLALTALPDPDLPGMPEMQ
APVASRRKPPSAFREWRLLGPLRKPTTQLRAKVSSLSHRIRIGGAQRAEAACAQRSEVEA
VSLGVPHDVTEGATCQAYELADYSNLRETDI
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgactttccgcgatctcctgagcgtcagtttcgagggaccccgcccagacagcagcgca
gggggctccagcgctggcggcggcgggggcagtgcgggcggcgcggctccctcagagggc
ccggcggtgggcggcgtgccgggggccgcgggcggcggcggcggcggcgtggtgggtgca
ggcagtggcgaggacaaccggagctccgcaggggagccggggagcgcgggtgcgggcggc
gacgtgaatggcacggcggccgtcggggggctggtggtgagcgcgcagggcgtgggtgtg
ggtgtcttcctagcagccttcatccttatggccgtggcgggtaacctgcttgtgatcctc
tcagtggcctgcaaccgccacctgcagactgtcaccaactatttcatcgtgaacctggca
gtggccgacctgctgcttagcgccacggtgctgcccttctcggccaccatggaggttctg
ggcttctgggcctttggccgggccttctgcgacgtgtgggcagccgtggacgtgctgtgc
tgtacggcctccatcctcagcctgtgcaccatctccgtggaccggtacgtgggcgtgcgc
cactcactgaagtacccagccatcatgaccgagcgcaaggcggccgccatcctggcgctg
ctctgggtcgtagccctggtggtgtctgtagggccgctgctgggctggaaggagcctgtg
ccccctgacgagcgcttctgcggcatcacggaggaggctggctacgctgtcttctcctcc
gtgtgctccttctacctgcccatggcggtcatcgtggtgatgtactgccgcgtgtacgtg
gtcgcgcgcagcaccacgcgcagcctcgaggcgggcgtcaagcgagagcggggcaaagcc
tccgaggtggtgctgcgcatccactgtcgcggagcggccacgggcgcggacggggcgcac
ggcacgcgcagcgccaagggccacaccttccgcagctcgctctcggtgcgcctgctcaag
ttctcccgtgagaagaaagcggccaaaacgctggccatcgtcgtgggcgtcttcgtgctc
tgctggttccctttcttctttgtcctgccgctcggctccctgttcccgcagctgaagcca
tcggagggcgtctttaaggtcatcttctggctcggttacttcaacagctgtgtgaacccg
ctcatctacccctgttccagccgcgagttcaagcgcgccttcctccgcctcctgcgctgc
caatgccgtcgtcgccggcgccgccgccccctctggcgagtctacggccaccactggcgg
gcctccaccagcggcctgcgccaggattgcgccccgagctcgggcgccgcgccccccgga
gcgccgctggccctcaccgcgctccccgaccccgacctcccaggcatgcccgagatgcag
gctccggtcgccagccgtcgaaagccacccagcgccttccgcgagtggaggctgctgggg
ccgctccggaaacccaccacccagctgcgcgccaaagtctccagcctgtcgcacaggatc
cgcatcgggggcgcgcagcgcgcagaggcagcgtgcgcccaacgctcagaggtggaggcc
gtgtccctaggcgtcccccacgatgtgaccgagggcgccacctgccaggcctacgaattg
gccgactacagcaacctacgggagactgatatttaa

DBGET integrated database retrieval system