KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398229Help
Entry
100398229         CDS       T03264                                 

Gene name
DVL2
Definition
(RefSeq) dishevelled segment polarity protein 2
  KO
K02353  segment polarity protein dishevelled
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04330  Notch signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100398229 (DVL2)
   04330 Notch signaling pathway
    100398229 (DVL2)
   04390 Hippo signaling pathway
    100398229 (DVL2)
   04150 mTOR signaling pathway
    100398229 (DVL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100398229 (DVL2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100398229 (DVL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100398229 (DVL2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100398229 (DVL2)
   05226 Gastric cancer
    100398229 (DVL2)
   05217 Basal cell carcinoma
    100398229 (DVL2)
   05224 Breast cancer
    100398229 (DVL2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100398229 (DVL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100398229 (DVL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 PDZ_2 Shufflon_N
Motif
Other DBs
NCBI-GeneID: 100398229
NCBI-ProteinID: XP_017827838
Ensembl: ENSCJAG00000016678
UniProt: U3DK46
LinkDB All DBs
Position
5
AA seq 736 aa AA seqDB search
MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPAHEPRTELAPPAPPLPPL
PPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRERPRRRDSSEHGAGGHRTS
GPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSIH
TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYIFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP
GAAPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG
AGRTGRPEERAPESKSGSGSESEPSSRGGSLRWGGEPSGTGDGGPPSSRGSSGGAPNLRA
HPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQS
FHMAMGNPSEFFVDVM
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcagcagcactgggggcggtggggttggggagacgaaggtgatttaccacctg
gatgaagaagagactccctacctggtgaagatccctgtccctgccgagcgcatcaccctc
ggcgatttcaagagcgttctgcagcggcccgcgggcgccaagtactttttcaagtctatg
gatcaggattttggggtggtgaaggaagaaatttcagatgacaacgcccgcctcccctgc
ttcaacggaagggttgtatcctggctggtgtcttcagataatccccagcccgagatggct
cctccagcccatgagcctcggacagaactggcgcctccagccccacctctaccacctttg
ccacctgagaggaccagtggcattggggactcgaggcctccatccttccaccctaatgtg
tccagcagccacgagaatctggagcctgagacagaaaccgagtcagtagtgtcactgagg
cgggagcggcctcgaaggagagacagcagtgagcatggcgcggggggccacaggaccagt
ggcccctcaaggctggagcgacacctggctggatatgagagctcctctaccctcatgacc
agcgagctggagagtactagcctgggggactcggatgaggaggataccatgagcaggttc
agcagctccacggagcagagcagtgcctcccgcctcctgaagcgccaccggcggcggagg
aaacagcggccacctcgcctggagaggacctcatccttcagcagtgtcacggattccaca
atgtctctgaatatcatcacagtcacgctgaacatggagaagtacaacttcctgggcatc
tccattgtgggccaaagcaatgagcggggagatggaggcatttacattggttccatcatg
aagggtggggccgtggcagccgatgggcgcattgagccaggggacatgcttttgcaggtg
aatgacatgaactttgagaacatgagcaatgatgacgccgtgcgggtgctgagggacatt
gtgcacaagcctggccccatcgtgctgactgtggccaagtgctgggatccctctcctcag
gcctacttcaccctcccccgaaatgagcccatccagccaattgaccctgctgcctgggtg
tcccactccgcggctctgactggcaccttcccagcctacccaggctcctcctccatgagc
accattacatcaggatcctctttgcctgatggctgtgagggccggggtctctccatccac
acagacatggcatcggtcactaaggccatggcagctccagagtctgggctggaagtccgg
gaccgcatgtggctcaagatcaccatccctaatgccttcctgggctcagatgtggttgac
tggctctaccatcatgtggagggctttccagagcggcgggaggcccgaaaatatgccagt
ggactgctcaaagctggcctgattcgacacactgtcaacaagatcaccttctctgagcag
tgctattacatcttcggagacctcagtggtggctgtgagagctacctagttaacctgtct
ctcaatgacaacgatggctccagtggggcttcagaccaggacaccctggcccctctgcct
ggggctgccccctggcccttgctgcccactttctcctaccagtacccagccccacatccc
tacagcccgcagcccccaccctaccatgagctttcatcttatacctatggtgggggcagt
gccagcagccagcacagtgagggcagccggagcagtgggtcgacacgaagtgatgggggg
gcagggcgcacagggaggcctgaggagcgggcccccgagtccaaatccggcagtggcagc
gagtctgagccctccagccgagggggcagccttcggtggggtggggaaccaagtgggact
ggcgatgggggccctccttcctccagaggctcaagtgggggtgcccctaatctccgagcc
cacccggggctccatccctatggaccaccccctggcatggccctcccctacaaccccatg
atggtggtcatgatgcccccacccccacccccagtccctccagcagtgcagcctccaggg
gcccctccagtcagagacctgggctctgtgcccccagaactgacagccagccgccaaagc
ttccacatggccatgggcaatcccagtgagttctttgtggatgttatgtag

DBGET integrated database retrieval system