KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398270
Entry
100398270         CDS       T03264                                 

Gene name
BMP4
Definition
(RefSeq) bone morphogenetic protein 4
  KO
K04662  bone morphogenetic protein 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04350  TGF-beta signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04919  Thyroid hormone signaling pathway
cjc05200  Pathways in cancer
cjc05217  Basal cell carcinoma
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100398270 (BMP4)
   04390 Hippo signaling pathway
    100398270 (BMP4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100398270 (BMP4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100398270 (BMP4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100398270 (BMP4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100398270 (BMP4)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100398270 (BMP4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100398270 (BMP4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100398270 (BMP4)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100398270 (BMP4)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100398270 (BMP4)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100398270 (BMP4)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100398270
NCBI-ProteinID: XP_002753963
Ensembl: ENSCJAG00000007270
LinkDB
Position
10
AA seq 408 aa
MIPGNRMLMVVLLCQVLLGGTSHASLIPENGKKKVAEIQGHAGGRRSGQSHELLRDFEAT
LLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQFHNTGLEYPERPASRANTVRSF
HHEEHLENIPGISENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWERGFHRINI
YEVMKPPTEVVPGHLIIRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTH
LHQTRTHQGQHVRIRRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHPQR
ARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTL
VNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgattcctggtaaccgaatgctgatggtcgttttattatgccaagtcctgctaggaggc
acgagccatgctagtttgatacctgagaacgggaagaaaaaagttgccgagattcagggc
cacgcgggaggacgccgctcagggcagagccatgagctcctgcgggacttcgaggccacg
cttctgcagatgttcgggctgcgccgccgcccgcagcctagcaagagtgcagtcattccg
gattacatgcgagatctttaccggcttcagtctggggaggaggaggaagagcagttccat
aacactggtctagagtatcctgagcgcccggctagccgggccaacaccgtgaggagcttc
caccacgaagaacatctggagaacatcccagggatcagtgaaaactctgcttttcgtttc
ctctttaacctcagcagcatcccagagaacgaggtgatctcctccgcagagctgcggctc
ttccgggagcaggtggaccagggccctgattgggaacggggcttccaccgtataaacatt
tatgaggttatgaagcccccaacagaagtggtgcctgggcacctcatcatacgactactg
gacacgagactggtccaccacaatgtgacacggtgggaaacttttgatgtgagcccagcg
gtccttcgctggacccgggagaagcagccgaactatgggctggccattgaggtgactcac
ctccatcaaactcggacccaccagggccagcatgtcaggattagacgatcgttacctcaa
gggagtgggaattgggcccaactccggcccctcctggtcacctttggccatgatggccgg
ggccatgctttaacccgacgccggagggccaagcgtagccctaagcatcacccacagcgg
gcccggaagaagaataagaactgccggcgccactcactctacgtggatttcagtgatgtg
ggctggaatgactggattgtggccccaccaggctaccaggccttctactgccatggggac
tgcccctttccactggctgaccacctcaactcaaccaaccatgccattgtgcagaccctg
gtcaattctgtcaattccagtatccccaaagcctgttgtgtgcccactgaactgagcgcc
atctccatgctgtacctggatgagtatgacaaagtggtactgaaaaattatcaagagatg
gtagtagagggatgtgggtgccgctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100408260
Entry
100408260         CDS       T03264                                 

Gene name
BMP2
Definition
(RefSeq) bone morphogenetic protein 2
  KO
K21283  bone morphogenetic protein 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04350  TGF-beta signaling pathway
cjc04390  Hippo signaling pathway
cjc05200  Pathways in cancer
cjc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100408260 (BMP2)
   04390 Hippo signaling pathway
    100408260 (BMP2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100408260 (BMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100408260 (BMP2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100408260 (BMP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100408260 (BMP2)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100408260 (BMP2)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100408260 (BMP2)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100408260 (BMP2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100408260
NCBI-ProteinID: XP_002747391
Ensembl: ENSCJAG00000021310
UniProt: F7G4N4
LinkDB
Position
5
AA seq 396 aa
MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAASSSGRPSSQPSDEVLSEFELRLLSM
FGLKQRPTPSRDAVVPPYMLELYRRHSGQPGAPAPDHRLERAASRANTVRSFHHEESVEE
LPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQEALGNNSSFHHRINIYEIIKPA
TANSKFPVTRLLDTRLVNENASRWESFDVTPAVMRWTAQGHANHGFVVEVTHLEEEQGVS
KRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHP
LYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKAC
CVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggtggccgggacccgctgtcttctagcgttgctgcttccccaggtcctcctgggcggc
gcggccggcctcgttccggagctgggccgcaggaagttcgcggcgtcgtcgtcgggccgc
ccctcgtcccagccctccgacgaggtcctgagcgagttcgaattgcggctgctcagcatg
ttcggcctgaagcagagacccacccccagcagggacgccgtggtgcccccctacatgcta
gagctgtatcgcaggcactcgggtcagccgggcgcacccgccccagaccaccggctggag
agggcagccagccgagccaacactgtgcgaagcttccaccatgaagaatcggtggaagaa
ctaccagaaaccagtgggaaaacaacccggcgattcttctttaatttgagttctatcccc
acggaggagttcatcacctcagcagagcttcaggtttttcgagaacagatgcaagaagct
ttaggaaacaatagcagtttccatcaccgaattaatatttatgaaatcataaaacctgca
acagccaactcaaaattccccgtgaccagacttttggacaccaggttggtgaatgagaat
gcaagcaggtgggaaagttttgacgtcacccccgctgtgatgcggtggactgcacaggga
catgccaaccatggattcgtggtggaggtgacccacttggaggaggaacaaggtgtctcc
aagagacatgttaggataagcaggtctttgcaccaagatgaacacagctggtcacagata
aggccattgctagtaacttttggccatgatgggaaagggcatcctctccacaaaagagag
aaacgtcaagcaaagcacaaacagcggaaacgcctcaagtccagctgtaagagacaccct
ttgtacgtggacttcagtgacgtggggtggaatgactggattgtggctcccccagggtat
catgccttttactgccacggagaatgcccttttcctctggctgatcatctgaactccact
aatcacgccattgttcagacgttggtcaactctgtgaactctaagattcctaaggcgtgc
tgtgtcccaacagaactcagtgctatctcgatgctgtaccttgacgaaaatgaaaaggtt
gtattaaagaactatcaggacatggttgtggagggttgtgggtgtcgctag

DBGET integrated database retrieval system