KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398505
Entry
100398505         CDS       T03264                                 

Gene name
SUFU
Definition
(RefSeq) SUFU negative regulator of hedgehog signaling
  KO
K06229  suppressor of fused
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04340  Hedgehog signaling pathway
cjc05200  Pathways in cancer
cjc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100398505 (SUFU)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100398505 (SUFU)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100398505 (SUFU)
SSDB
Motif
Pfam: SUFU_C SUFU
Other DBs
NCBI-GeneID: 100398505
NCBI-ProteinID: XP_017834763
Ensembl: ENSCJAG00000018029
UniProt: F6U4B5
LinkDB
Position
12
AA seq 485 aa
MAELRPSGAPGPTAPPAPGPTAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKY
WLGGPDPLDYVSMYRNVGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFEL
TFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLT
EDPQMQPVQTPFGLVTFLQIVGVCTEELHSAQQWNGQGILELLRTVPVAGGPWLITDMRR
GETIFEIDPHLQQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICIGTQPRR
LSGKDTEQIRETLRRGLEINSKPVLPPINPQRQNGLAHDRAPSRKDSLESDSSTAIIPHE
LIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFAT
EEHPYAAHGPWLQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVF
DSPLH
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcggagctgcggcctagcggcgcccctggccccaccgcgcccccggcccctggcccg
actgcccccccggccttcgcctctctcttccccccgggactgcacgccatctacggagag
tgccgccgcctttaccctgaccagccaaacccgctccaggttaccgctatcgtgaagtac
tggttgggcggcccggaccccttggactatgttagcatgtacaggaatgtggggagccct
tctgccaacatccccgagcactggcactacatcagctttggcctgagtgatctctatgga
gacaacagagtccatgagtttacaggaacagatggacctagtggttttggctttgagttg
acctttcgtctgaagagagaaactggggagtctgccccaccaacatggcccgcagagtta
atgcagggcttggcacgatatgtgttccagtcagagaacaccttctgcagtggggaccat
gtgtcctggcacagccctttggataacagtgagtcaagaattcagcacatgctgctgaca
gaggacccacagatgcagcccgtacagacaccctttgggttagtcaccttcctccagatc
gttggtgtctgcactgaggagctacactcagcccagcagtggaatgggcagggcatcctg
gagctgctgcggacagtacctgtcgctggaggcccctggctgataactgacatgcggagg
ggagagactatatttgagatcgatccacacctgcaacaggagagagttgacaaaggcatt
gagacagacggctccaacctgagtggtgtcagtgccaaatgtgcctgggacgacctgagc
cggccccccgaggatgacgaggacagccggagcatctgcatcggcacacagccccggcgg
ctctctggcaaagacacagagcagatccgggagaccttgaggagaggactcgagatcaac
agcaaacctgtccttccaccaatcaaccctcagcggcagaatggcctcgcccacgaccgg
gccccgagccgtaaagacagcctggaaagtgacagctccacggccatcattccccatgag
ctcattcgcacacggcaactcgagagtgtacatctgaaattcaaccaggagtccggagcc
ctcattcctctctgcctaaggggcaggctcctgcatggacggcactttacatataaaagt
atcacaggggacatggccatcacgtttgtctccacgggagtagaaggcgcctttgccaca
gaggagcatccttacgcggctcatggaccctggttacaaattctgttgaccgaagaattt
gtagagaaaatgttggaggatttagaagatttgacttctccagaggaattcaaacttccc
aaagagtacagctggcctgaaaagaagctgaaggtctccatcctgcctgatgtggtattc
gacagtccgctacactag

DBGET integrated database retrieval system