KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398993
Entry
100398993         CDS       T03264                                 

Gene name
FSHB
Definition
(RefSeq) follicle stimulating hormone beta subunit
  KO
K05250  follitropin subunit beta
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100398993 (FSHB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100398993 (FSHB)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100398993 (FSHB)
   04913 Ovarian steroidogenesis
    100398993 (FSHB)
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 100398993
NCBI-ProteinID: XP_002755177
Ensembl: ENSCJAG00000006121
UniProt: F7IQC9
LinkDB
Position
11
AA seq 129 aa
MKTVQFCFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDP
ATPNIQTTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCESDSTDCTMQGLGPD
YCSFSEMKE
NT seq 390 nt   +upstreamnt  +downstreamnt
atgaagacagtccagttttgcttccttttctgctgctggaaagcaatctgctgcaatagc
tgtgagctaaccaacatcaccattgcaatagagaaggaagaatgtcgtttctgcataagc
atcaacaccacttggtgtgctggctactgttacaccagggatctggtgtataaggaccca
gccacgcccaacatccagacaacatgtaccttcaaggaactggtgtacgagacagtgaga
gtgcccggctgcgctcaccatgcagactccttgtatacttacccagtggccacccagtgt
cactgtggcaagtgtgaaagcgacagcactgactgcacaatgcaaggcctgggacccgac
tactgctccttcagtgaaatgaaagaataa

DBGET integrated database retrieval system