KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399018
Entry
100399018         CDS       T03264                                 

Gene name
STX1A
Definition
(RefSeq) syntaxin 1A
  KO
K04560  syntaxin 1A
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04130  SNARE interactions in vesicular transport
cjc04721  Synaptic vesicle cycle
cjc04911  Insulin secretion
cjc05016  Huntington disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05031  Amphetamine addiction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    100399018 (STX1A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100399018 (STX1A)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    100399018 (STX1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    100399018 (STX1A)
   05022 Pathways of neurodegeneration - multiple diseases
    100399018 (STX1A)
  09165 Substance dependence
   05031 Amphetamine addiction
    100399018 (STX1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100399018 (STX1A)
Membrane trafficking [BR:cjc04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    100399018 (STX1A)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 Ferritin GNVR PspA_IM30 Prominin Laminin_II Syntaxin-6_N FAD_binding_1 DUF1910 Lzipper-MIP1 SIMPL FlgN ETRAMP CHDCT2 DUF148 Lipoprotein_2 CorA
Other DBs
NCBI-GeneID: 100399018
NCBI-ProteinID: XP_002743976
Ensembl: ENSCJAG00000016769
LinkDB
Position
2
AA seq 304 aa
MRGYKAAAGAATTPGSMKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFI
DKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEE
GLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEE
LEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVE
SQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIVIASTVG
GIFA
NT seq 915 nt   +upstreamnt  +downstreamnt
atgaggggctacaaggctgcggccggagccgctaccactcccgggagcatgaaggaccga
acccaggagctccgcacggccaaggacagcgatgatgatgacgatgtcgctgtcaccgtg
gaccgagaccgcttcatggatgagttctttgagcaggtggaggagattcgaggcttcatt
gacaagatcgcagagaacgtggaggaggtgaagcggaagcacagcgccatcctggcctcc
cccaaccctgatgagaagacgaaggaggagctggaagaactcatgtcggacataaagaag
acagcgaacaaagtccgatccaaattaaagagcatcgagcagtccatcgagcaggaggaa
ggcctgaaccgctcctccgctgacctgaggatccggaagacacagcactccacactatcc
agaaagtttgtggaggtcatgtcggagtacaacgccacgcagtccgactaccgcgagcgc
tgcaagggccgcatccagaggcaactggagatcactggccggaccacgaccagtgaggag
ctggaagacatgctggagagtgggaaccctgccatctttgcctctggtatcatcatggac
tccagcatctcgaagcaggctctgagcgagattgagacacggcacagcgagatcattaag
ctggagaacagcatccgtgagctgcatgacatgttcatggacatggccatgctggtggag
agccagggggaaatgattgacaggatcgagtataatgtggagcatgcggtggactacgtg
gagagggctgtgtctgataccaagaaggccgtcaaataccagagcaaggcacgccggaag
aaaatcatgatcatcatctgctgtgtgatcctgggcatcgtcatcgcctccacggtcggg
ggcatcttcgcctag

DBGET integrated database retrieval system