KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399074
Entry
100399074         CDS       T03264                                 

Gene name
GCG
Definition
(RefSeq) glucagon
  KO
K05259  glucagon
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04714  Thermogenesis
cjc04911  Insulin secretion
cjc04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100399074 (GCG)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100399074 (GCG)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100399074 (GCG)
   04922 Glucagon signaling pathway
    100399074 (GCG)
  09159 Environmental adaptation
   04714 Thermogenesis
    100399074 (GCG)
SSDB
Motif
Pfam: Hormone_2 MPM1
Other DBs
NCBI-GeneID: 100399074
NCBI-ProteinID: XP_002749449
UniProt: F7ID40
LinkDB
Position
6
AA seq 263 aa
MQMSKVSGRGKSFVTKTHYLQMRNLYCQRNICEAKQSWRVYKSSVPWCRSAELRTQSTSK
VPKEGLLSLHLLCSTAHYWKTAEMKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQ
TDPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFER
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNT
ILDNLAARDFINWLIQTKITDRK
NT seq 792 nt   +upstreamnt  +downstreamnt
atgcagatgagtaaagtgagtgggcgagggaaatcatttgtaacaaaaactcattattta
cagatgagaaatttatattgtcagcgtaatatctgtgaagctaaacagagctggagagta
tataaaagcagtgtgccttggtgcagaagtgcagagctcaggacacagagcacatcaaaa
gttcccaaagagggcttgctctctcttcacctgctctgttccacagcacactactggaag
acagcagaaatgaaaagcatttactttgtggctggattgtttgtaatgctggtacaaggc
agctggcaacgttcccttcaagacacagaggagaaatccagatcattctcagcttcccag
acagaccctctgagtgatcctgatcaaatgaatgaggacaagcgccactcacagggcaca
ttcaccagtgactacagcaagtatctggactccaggcgtgcccaagattttgtgcagtgg
ctgatgaataccaagaggaacaggaataacattgccaaacgtcacgatgaatttgagaga
catgctgaagggacctttaccagtgatgtaagttcttatttggaaggccaagctgccaag
gaattcattgcttggctggtgaaaggccgaggaaggcgagatttcccggaagaggtcgct
attgttgaagaacttggccgcagacatgctgatggttctttctctgatgagatgaacaca
atccttgataatcttgctgccagggactttataaactggttgattcaaaccaaaatcact
gacaggaaataa

DBGET integrated database retrieval system