KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399082Help
Entry
100399082         CDS       T03264                                 

Gene name
ALPI
Definition
(RefSeq) alkaline phosphatase, intestinal
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00730  Thiamine metabolism
cjc00790  Folate biosynthesis
cjc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    100399082 (ALPI)
   00790 Folate biosynthesis
    100399082 (ALPI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100399082 (ALPI)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cjc00537]
    100399082 (ALPI)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100399082 (ALPI)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100399082 (ALPI)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cjc00537]
 Enzymes
  100399082 (ALPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 100399082
NCBI-ProteinID: XP_008997950
Ensembl: ENSCJAG00000013702
LinkDB All DBs
Position
6
AA seq 556 aa AA seqDB search
MQGLWVLLLLGLRLQLSLGVIPVEEENPGFWNRQAAEALDAAKKLQPIQRVAKNLILFLG
DGMGVPTVTATRILKGQSNGKLGPETPLAMDRFPYVALSKTYNVDRQVPDSAATATAYLC
GVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYA
HTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPTGTPDPEYPSDA
SQNGIRLDGKNLVQEWLAKHQGAQYVWNCTELMQASLDSSVTHLMGLFEPGDTKYEINRD
PTRDPSLMEMTEAALRLLSRNPLGFYLFVEGGRIDHGHHEGIAYHALTEAVMFDDAIERA
GQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSVFGLAPSKAQDSKAYTSILYGNGPGYAF
SSSVRPDVNESESGSPDYKQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFLAHI
MAFAACLDPYAACDLAPAAGTTGAAPPASTTDAASPAGTINSAPPASTSNAAHLAPQSLP
LLAGTLLLLLGAATAP
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggctgtgggtgctgctgctgctaggcctgaggctgcagctctccctgggcgtc
atcccagttgaggaggagaacccgggcttctggaaccgccaggcagctgaggccctggat
gctgccaagaagcttcagcccatccagagggtcgccaagaacctcatcctcttcctgggc
gacgggatgggggtacccacagtgacagccaccaggatcctaaaggggcagagtaatggc
aaactggggcctgagacacccctggccatggaccgcttcccatacgtggctctgtccaag
acatacaatgtggacagacaggtgccagacagcgcagccacagccacggcctacctgtgc
ggggtcaagggcaacttccagaccatcggcctgagcgcagccgcccgctttaaccagtgc
aacacgacccgcggcaacgaggtcatctccgtgatgaaccgggccaagaaggcagggaag
tctgtgggagtggtgaccaccacacgggtgcagcacgcctcaccggccggcacctacgca
cacacggtgaaccgcaactggtactcagatgctgacatgcctgcctcggcccgccaggag
ggctgccaggacatcgccacgcagctcatctccaacatggacattgacgtgatcttgggc
ggaggtcgaaagtacatgtttcccacggggaccccagaccctgagtacccaagtgatgcc
agccagaacggaatcaggctggacggaaagaacctggtgcaggaatggctggcgaagcac
cagggtgcccagtatgtgtggaactgcactgagctcatgcaggcttccctggactcctct
gtgacccacctcatgggcctctttgagcccggagacacgaaatatgagatcaaccgagac
cccacacgagacccctccttgatggagatgacggaggccgccctacgcctgctaagcagg
aatcccctcggcttctacctcttcgtggagggcggccgcatcgaccatggtcatcatgag
ggcatagcttatcatgcgctgacggaggcggtcatgtttgacgatgccatcgagagagcg
ggccagctcaccagcgaggaggacacgctgacccttgtcaccgctgaccactcccatgtc
ttctcctttggtggatacaccttgcgagggagctccgtcttcgggctggcccccagcaag
gctcaggacagcaaagcctacacgtccatcctgtatggcaatggcccaggctacgcgttc
agctcaagcgtgcgaccagacgtgaatgagagcgagagcgggagccccgattacaagcag
caggcggcggtgcccctgtcgtctgagacccacggaggcgaagacgtggcggtgttcgcg
cgcggcccgcaggcgcacctggtgcacggtgtgcaggagcagagcttcttagcacacatc
atggccttcgccgcctgcctggatccctacgcggcctgcgacctggcgcccgccgccggc
accacgggtgccgcccctccagccagcaccaccgacgccgcctctcccgccggcaccatc
aactccgcgcctcctgccagcaccagcaacgccgcccacctggctccccagtcgctgcct
ctgctggctgggaccctgctgctgctgctgggggcggccactgctccctga

DBGET integrated database retrieval system