KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399690Help
Entry
100399690         CDS       T03264                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04110  Cell cycle
cjc04213  Longevity regulating pathway - multiple species
cjc04330  Notch signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc05016  Huntington's disease
cjc05034  Alcoholism
cjc05165  Human papillomavirus infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05203  Viral carcinogenesis
cjc05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cjc00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100399690 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100399690 (HDAC1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100399690 (HDAC1)
  Aging
   04213 Longevity regulating pathway - multiple species
    100399690 (HDAC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100399690 (HDAC1)
   05202 Transcriptional misregulation in cancers
    100399690 (HDAC1)
   05203 Viral carcinogenesis
    100399690 (HDAC1)
   05220 Chronic myeloid leukemia
    100399690 (HDAC1)
  Neurodegenerative diseases
   05016 Huntington's disease
    100399690 (HDAC1)
  Substance dependence
   05034 Alcoholism
    100399690 (HDAC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    100399690 (HDAC1)
   05165 Human papillomavirus infection
    100399690 (HDAC1)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100399690 (HDAC1)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100399690 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     100399690 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100399690 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    100399690 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100399690
NCBI-ProteinID: XP_002750618
Ensembl: ENSCJAG00000000970
UniProt: F7GTK7
LinkDB All DBs
Position
7
AA seq 482 aa AA seqDB search
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKEPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagacgcagggcacccggaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcataat
ttgctgctcaactatggtctctaccgaaaaatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagcgatgactacattaaattcttgcgctccatccgt
ccagataacatgtccgagtacagcaagcagatgcagagattcaacgttggtgaggactgt
ccagtattcgatggcctgtttgagttctgtcagttgtctactggtggttctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcac
catgcaaagaagtccgaggcatctggcttctgttacgtcaatgatattgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccatggc
gacggtgtggaagaggccttctatactacagaccgggtcatgactgtgtcctttcataag
tatggagagtacttcccaggaactggggacctacgggatatcggggctggcaaaggcaag
tattatgctgttaactacccgctccgagatgggattgatgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccagcctagtgccgtggtcttacag
tgtggctcagactccctatctggggatcggttaggttgcttcaatctgaccatcaaaggg
cacgccaagtgtgtggaatttgtcaagagctttaacctgcctatgctgatgctgggagga
ggtggttacaccattcgtaatgtcgcccgatgctggacgtacgagacagctgtggccctg
gatacggagatccctaatgagcttccatacaacgactacttcgaatactttggaccagat
ttcaagctccacatcagtccttccaatatgactaaccagaacacgaatgagtacttggag
aagatcaaacagcgactgtttgagaacctgaggatgctgccgcatgcacccggggtccaa
atgcaggcgattcctgaggacgccatccctgaggagagtggtgatgaagacgaagaagac
cctgacaagcgcatctcgatctgctcctctgacaaacgaattgcctgtgaggaagagttc
tcagactctgaagaggagggagaggggggccgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaacagaggatgaaaaagagaaagagccagaggagaagaaagaagtcaca
gaagaggagaaaaccaaggaggagaagccagaagccaaaggggtcaaagaggaggtcaag
ttggcctaa

DBGET integrated database retrieval system