KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399690
Entry
100399690         CDS       T03264                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04110  Cell cycle
cjc04213  Longevity regulating pathway - multiple species
cjc04330  Notch signaling pathway
cjc04613  Neutrophil extracellular trap formation
cjc04919  Thyroid hormone signaling pathway
cjc05016  Huntington disease
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
cjc05165  Human papillomavirus infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05203  Viral carcinogenesis
cjc05206  MicroRNAs in cancer
cjc05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100399690 (HDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100399690 (HDAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100399690 (HDAC1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100399690 (HDAC1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100399690 (HDAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100399690 (HDAC1)
   05202 Transcriptional misregulation in cancer
    100399690 (HDAC1)
   05206 MicroRNAs in cancer
    100399690 (HDAC1)
   05203 Viral carcinogenesis
    100399690 (HDAC1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100399690 (HDAC1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100399690 (HDAC1)
  09165 Substance dependence
   05031 Amphetamine addiction
    100399690 (HDAC1)
   05034 Alcoholism
    100399690 (HDAC1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100399690 (HDAC1)
   05165 Human papillomavirus infection
    100399690 (HDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100399690 (HDAC1)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100399690 (HDAC1)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100399690 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     100399690 (HDAC1)
    BRAF-HDAC complex
     100399690 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100399690 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    100399690 (HDAC1)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 100399690
NCBI-ProteinID: XP_002750618
Ensembl: ENSCJAG00000000970
UniProt: F7CCQ4
LinkDB
Position
7
AA seq 482 aa
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKEPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcgcagacgcagggcacccggaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcataat
ttgctgctcaactatggtctctaccgaaaaatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagcgatgactacattaaattcttgcgctccatccgt
ccagataacatgtccgagtacagcaagcagatgcagagattcaacgttggtgaggactgt
ccagtattcgatggcctgtttgagttctgtcagttgtctactggtggttctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcac
catgcaaagaagtccgaggcatctggcttctgttacgtcaatgatattgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccatggc
gacggtgtggaagaggccttctatactacagaccgggtcatgactgtgtcctttcataag
tatggagagtacttcccaggaactggggacctacgggatatcggggctggcaaaggcaag
tattatgctgttaactacccgctccgagatgggattgatgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccagcctagtgccgtggtcttacag
tgtggctcagactccctatctggggatcggttaggttgcttcaatctgaccatcaaaggg
cacgccaagtgtgtggaatttgtcaagagctttaacctgcctatgctgatgctgggagga
ggtggttacaccattcgtaatgtcgcccgatgctggacgtacgagacagctgtggccctg
gatacggagatccctaatgagcttccatacaacgactacttcgaatactttggaccagat
ttcaagctccacatcagtccttccaatatgactaaccagaacacgaatgagtacttggag
aagatcaaacagcgactgtttgagaacctgaggatgctgccgcatgcacccggggtccaa
atgcaggcgattcctgaggacgccatccctgaggagagtggtgatgaagacgaagaagac
cctgacaagcgcatctcgatctgctcctctgacaaacgaattgcctgtgaggaagagttc
tcagactctgaagaggagggagaggggggccgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaacagaggatgaaaaagagaaagagccagaggagaagaaagaagtcaca
gaagaggagaaaaccaaggaggagaagccagaagccaaaggggtcaaagaggaggtcaag
ttggcctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402327
Entry
100402327         CDS       T03264                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04110  Cell cycle
cjc04213  Longevity regulating pathway - multiple species
cjc04330  Notch signaling pathway
cjc04613  Neutrophil extracellular trap formation
cjc04919  Thyroid hormone signaling pathway
cjc05016  Huntington disease
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
cjc05165  Human papillomavirus infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05203  Viral carcinogenesis
cjc05206  MicroRNAs in cancer
cjc05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100402327 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100402327 (HDAC2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100402327 (HDAC2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100402327 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100402327 (HDAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100402327 (HDAC2)
   05202 Transcriptional misregulation in cancer
    100402327 (HDAC2)
   05206 MicroRNAs in cancer
    100402327 (HDAC2)
   05203 Viral carcinogenesis
    100402327 (HDAC2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100402327 (HDAC2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100402327 (HDAC2)
  09165 Substance dependence
   05031 Amphetamine addiction
    100402327 (HDAC2)
   05034 Alcoholism
    100402327 (HDAC2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100402327 (HDAC2)
   05165 Human papillomavirus infection
    100402327 (HDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100402327 (HDAC2)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100402327 (HDAC2)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100402327 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     100402327 (HDAC2)
    BRAF-HDAC complex
     100402327 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100402327 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    100402327 (HDAC2)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 100402327
NCBI-ProteinID: XP_008993185
Ensembl: ENSCJAG00000004635
LinkDB
Position
4
AA seq 458 aa
MKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSK
QMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASG
FCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTG
DLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGD
RLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELP
YNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAV
HEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEED
KKETEDKKADVKEEDKSKDNSGEKTDTKGTKSEQLSNP
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgaagcctcatagaatccgcatgacccataacttgctgttaaattatggcttatacaga
aaaatggaaatatatagaccccataaagccactgccgaagaaatgacaaaatatcacagt
gatgagtatatcaaatttctgcggtcaataagaccagataacatgtctgagtatagtaag
cagatgcagagatttaatgttggagaagattgtcctgtgtttgatggactctttgagttt
tgtcagctctcaactggtggttcagttgctggggcggtgaagttaaatcgacaacagact
gatatggctgttaattgggctggaggattacatcatgctaagaaatcagaagcatcagga
ttctgttatgttaatgatattgtccttgccatccttgaattactaaagtatcatcagaga
gtcttatatattgatatagatattcatcatggtgatggtgttgaagaagctttttataca
acagatcgtgtaatgacggtatcattccataaatatggggaatactttcctggcacagga
gacttgagggatattggtgctggaaaaggcaaatactatgccgtcaattttccaatgaga
gatggtatagatgatgagtcatatgggcagatatttaagcctattatctcaaaggtgatg
gagatgtatcaacctagtgctgtggtattacagtgtggtgcagactcattatctggtgat
agactgggttgtttcaatctaacagtcaaaggtcatgctaaatgtgtagaagttgtaaaa
acttttaacttaccgttactgatgcttggaggaggtggatacacaatccgtaatgttgct
cgatgttggacatatgagactgcagttgcccttgattgtgagattcccaatgagttgcca
tataatgattactttgagtattttggaccagacttcaaactgcatattagtccttcaaat
atgacaaaccagaacactccagaatatatggaaaagataaagcagcgtttatttgaaaat
ttgcgcatgttacctcacgcacctggtgtccagatgcaagctatcccagaagatgctgtt
catgaagacagtggcgatgaagatggagaagatccagacaagagaatttctattcgagca
tcagacaagcggatagcttgtgatgaagaattctcagattctgaggatgaaggagaagga
ggtcgaagaaatgtggctgatcataagaaaggagctaaaaaggctagaattgaagaagat
aagaaagaaacagaggacaaaaaagcagatgttaaagaagaagataaatccaaggacaac
agtggtgaaaaaacagataccaaaggaaccaaatcagaacagctcagcaacccctga

DBGET integrated database retrieval system