KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399761
Entry
100399761         CDS       T03264                                 

Gene name
EREG
Definition
(RefSeq) epiregulin
  KO
K09784  epiregulin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100399761 (EREG)
   04012 ErbB signaling pathway
    100399761 (EREG)
   04151 PI3K-Akt signaling pathway
    100399761 (EREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    100399761 (EREG)
SSDB
Motif
Pfam: Herpes_gE EGF CD34_antigen Sec66 Sigma_reg_N DUF2207 Adeno_hexon_C
Other DBs
NCBI-GeneID: 100399761
NCBI-ProteinID: XP_008991427
Ensembl: ENSCJAG00000013863
LinkDB
Position
3
AA seq 163 aa
MEMLCAVRVPALFLCLGFHLLQAVLSTTVIPSCIPAESNDNCTALVQTEDDPRVAQVSIT
KCSYDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSREYVALTVILI
ILFLIIIVGSTYYFCRWYRSRKSKEPKKEYERVTLGDPELPQV
NT seq 492 nt   +upstreamnt  +downstreamnt
atggagatgctctgtgccgtcagggtccccgcgctgttcctctgcctgggcttccatctt
ctacaggcagtcctcagtacaactgtgattccatcatgtatcccagcagagtccaacgat
aactgcacagccttagttcaaacagaagacgatccacgtgtggctcaagtgtcaataaca
aaatgtagctatgacatgaatggttactgtttgcatggacagtgcatctacctggtggac
atgagtcaaaactactgcaggtgcgaagtgggttatactggtgtccgatgtgaacacttc
tttttaaccgtccaccaacctttaagcagagaatatgtggctttgaccgtgattcttatt
attttgtttcttatcatcattgttggttccacatattatttctgcagatggtacagaagt
cgaaaaagtaaagaaccgaagaaggaatatgagagggttaccttaggggatccagagttg
ccacaagtctga

DBGET integrated database retrieval system