KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399968
Entry
100399968         CDS       T03264                                 

Gene name
BCL2L11
Definition
(RefSeq) BCL2 like 11
  KO
K16341  Bcl-2-like protein 11
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc04068  FoxO signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04932  Non-alcoholic fatty liver disease
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05206  MicroRNAs in cancer
cjc05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100399968 (BCL2L11)
   04151 PI3K-Akt signaling pathway
    100399968 (BCL2L11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100399968 (BCL2L11)
   04215 Apoptosis - multiple species
    100399968 (BCL2L11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100399968 (BCL2L11)
   05206 MicroRNAs in cancer
    100399968 (BCL2L11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100399968 (BCL2L11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100399968 (BCL2L11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100399968 (BCL2L11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100399968 (BCL2L11)
SSDB
Motif
Pfam: Bclx_interact Bim_N PMAIP1
Other DBs
NCBI-GeneID: 100399968
NCBI-ProteinID: XP_002757542
Ensembl: ENSCJAG00000004445
UniProt: A0A2R8MYX7
LinkDB
Position
14
AA seq 200 aa
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSP
QGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPP
CQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDH
PHMVILRLLRYIVRLVWRMH
NT seq 603 nt   +upstreamnt  +downstreamnt
atggcaaagcaaccttccgatgtaagttctgagtgtgaccgagaaggtagacaattgcag
cctgcggagagacctccccagctcagacctggggcccctacctccctacagacagagcca
caaggtaatcccgaaggcaatcacggaggtgaaggggacagctgcctccacggcagccct
cagggcccgctggccccaccggccagccccggcccttttgctaccagatccccgcttttc
atctttgtgagaagatcctccgtgctgtctcgatcctccagtgggtatttctcttttgac
acagacaggagcccagcacccatgagttgtgacaaatcaacacaaaccccaagtcctcct
tgccaggccttcaaccactatctcagtgcaatggcttccatgaggcaatctcaggctgaa
cctgcaggtatgcgcccggagatatggatcgcccaagagttgcggcgtatcggagacgag
tttaacgcttattatccaaggagggtatttttgaataattaccaagcagctgaagaccac
ccacacatggttatcttacgactgttacgttacattgtccgcctggtgtggagaatgcat
tga

DBGET integrated database retrieval system