KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400006Help
Entry
100400006         CDS       T03264                                 

Gene name
BAG6, BAT3
Definition
(RefSeq) BCL2 associated athanogene 6
  KO
K23390  large proline-rich protein BAG6
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100400006 (BAG6)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic type
  Check point factors
   BAG6-UBL4A-GET4 complex
    100400006 (BAG6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAG6 ubiquitin Rad60-SLD DUF2407 TBK1_ULD Rad60-SLD_2 Ubiquitin_5
Motif
Other DBs
NCBI-GeneID: 100400006
NCBI-ProteinID: XP_008992396
Ensembl: ENSCJAG00000003019
LinkDB All DBs
Position
4
AA seq 1141 aa AA seqDB search
MCVFVQEKLFRELSAMEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGSQMNVKEFKEH
IAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTQLPSGASSGTGSA
SATHGGGPPPGTRGPGASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVR
LVMAQHMIRDIQTLLSRMECRGGSQPQHSQPPPQPPTVTPEPVALSSQTSEPAESEAPPR
EPMEAEEVEEHTPAQNPELTPSGPAPAGPTPAPETNAPNHPSPAEYVEVLQELQRLESRL
QPFLQRYYEVLGAAATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACA
PPRHLHVVRPMSHYTTPMVLQQAAIPIQINVGTTVTMTGNGTRPPPTPNAEAPPPGPGQA
SSVAPSSTNVESSTEGAPPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGTQPGG
VPSAPTGSLGPPGHGQTLGQQVPGFPTAPTRVVIARPTPPQARPSHPGGPPVSGTLQGAG
LGTNASLAQMVSGLVGQLLMQPVLVAQGTSGMAPPPAPATASASAGTTNTATTAGPAPGG
PAQPPPTQPSTADLQFSQLLGNLLGPAGPGAGGPGVASPTITVAMPGVPAFLQGMTDFLQ
ATQTAPPPPPPPPPPPPAPEQQTMPPPGSPSGGAGSPGGLGLESLSPEFFTSVVQGVLSS
LLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDVVMLL
HGHFQPLQRLQPQLRSFFHQHYLGGQEPTPSNIRMATHTLITGLEEYVRESFSLVQVQPG
VDIIRTNLEFLQEQFNSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMEL
AAVINGRIRRMSRGVNPSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLP
EEPMEVQGAERASPEPQRENASPAPGTTAEEVMSRGPPPAPEGGSRDEQDGASAETEPWA
AAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAA
KAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAHRAFADD
P
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgtgtttgtacaggagaaactttttagagagctgtcggccatggagcctaatgat
agtaccagtacggctgtggaggagcctgacagtttggaggtgctggtgaagaccctggac
tctcaaactcggacctttattgtggggtcccagatgaatgtgaaagagtttaaggagcac
attgctgcctctgtcagcatcccatctgaaaaacaacggctcatttaccagggacgagtt
ctgcaagatgataagaagctccaggaatataatgttgggggaaaggttatccacctggtg
gaacgggctcctcctcagactcagctcccttctggggcatcttctgggacggggtctgcc
tcagccactcatggtgggggacccccgcctggtactcgggggcctggggcctctgttcat
gaccggaatgccaacagctatgtcatggttggaaccttcaatcttcctagtgacggctct
gctgtggatgttcacatcaacatggaacaggccccgattcagagtgagccccgggtacgg
ctggtgatggctcagcacatgatcagggatatacagaccttactatcccggatggagtgt
cgagggggttcccaaccgcagcacagccagccacccccgcagccaccaactgtgaccccg
gagccagtagccttgagctctcaaacatcagaaccagctgaaagtgaagcacctcctcgg
gagcccatggaggcagaagaagtggaagagcacaccccagcccaaaacccagagctcacc
ccttctggcccagccccagcgggcccaacacctgccccagagacaaatgcacccaaccat
ccttcccctgcggagtatgtcgaggtgctccaggagctgcagcggctggagagccgcctc
cagcccttcttgcagcgctactacgaggttctaggtgctgctgccaccacagactacaat
aacaatcacgagggccgggaggaggatcagcggttgatcaacttggttggggagagcctg
cgattgctgggcaacacctttgtggcactatctgaccttcgctgcaatctggcctgtgcg
cccccacgacacctgcatgtggtccgccctatgtctcactataccacccccatggtgctc
cagcaggcagccattcccatacagatcaacgtgggaaccactgtgaccatgacaggaaat
gggactcggccccccccaactcccaatgcagaggcacctccccctggtcctgggcaggcc
tcgtctgtggctccgtcttctaccaatgttgagtcctcaactgagggggctcccccgcca
gggccggctcccccaccagccaccagccacccaagggtcatccggatttcccaccagagt
gtggaaccggtggtcatgatgcacatgaacattcaagattctggcacgcagcctggtggt
gttccgagtgctcccactggctccttgggaccccctggtcatggccaaaccctgggacaa
caggtgccaggctttccaacagctccaacccgggtagtgattgcccggcccacccctcca
caggctcgtccttcccatcctggagggcccccagtctctgggactctgcagggtgctggg
ctgggtaccaatgcctcgttagcccagatggttagcggccttgtggggcagcttcttatg
caacctgtccttgtggctcaagggacctcaggaatggctccaccaccagcccctgccact
gcttctgccagtgctggcaccaccaacacagctaccacagctggccctgcccctgggggg
cctgcccagcctccacccactcaaccctccacagctgatcttcagttctctcagcttctg
gggaatctgctagggcccgcagggccaggggctggagggcctggtgtggcttctcccacc
atcactgtggcgatgcctggtgtccctgcctttctccagggcatgactgacttcttgcag
gcaacacaaacagcccctccacccccgccacctcctccacccccaccacctgccccagag
cagcagaccatgcccccaccaggctccccttctggtggtgcagggagtcctggaggcctg
ggtctcgagagcctgtcaccagagttttttacttcagtggtgcagggtgtgctgagctcc
ctactgggctccttgggggctcgggctggcagcagtgaaagtattgctgccttcatacaa
cgcctcagtggatccagcaacatctttgagcctggagctgatggggcccttggattcttt
ggggccctgctgtctcttctgtgtcagaacttctctatggtggacgtagtgatgctcctc
catgggcatttccagccactacaacggctccagccccagctgcgatccttcttccaccag
cactacctgggtggtcaggagcccacacccagtaacatccggatggcaacccacacattg
atcacagggctagaagaatatgtgcgggagagtttttctttggtgcaggtgcagccaggt
gtggacatcatccggacaaacttggaatttctccaagagcagtttaatagcatagctgct
catgtgctgcactgcacagatagtggatttggggcccggttgctggagttgtgtaaccaa
ggcctgtttgaatgcctggccctgaacctgcattgcttggggggccaacagatggagctt
gctgctgttatcaatggccgaattcgtcgtatgtctcgtggggtgaatccctccttggtg
agctggctgaccactatgatgggactgaggcttcaggtggtactggagcacatgcccgta
ggccctgatgccattctcagatatgttcgcagagtcggtgatcccccccagccacttcct
gaggagccaatggaagttcagggagcagaaagagcttcccctgagcctcagcgggagaat
gcttccccagcccctggaacaacagcagaagaggtcatgtcccgaggtccacctcctgct
cctgaggggggctcccgagatgaacaggatggagcttcagctgagacagaaccttgggca
gctgcagtccccccagaatgggtccctattatccagcaggatattcagagccagcggaag
gtgaaaccgcagccccctctgagtgatgcctacctcagtggtatgcctgccaagagacgc
aagacaatgcagggtgagggcccccagctgcttctctcagaggctgtgagccgggcagct
aaggcagccggagctcggcccctgacgagccccgagagcctgagccgggacctggaggca
ccagaggttcaggagagctacaggcagcagctccggtctgatatacaaaaacgactgcag
gaagaccccaactacagtccccagcgcttccccaatgcccaccgggcctttgctgatgat
ccttag

DBGET integrated database retrieval system