KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400015Help
Entry
100400015         CDS       T03264                                 

Gene name
HNRNPUL1
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein U like 1
  KO
K15047  heterogeneous nuclear ribonucleoprotein U-like protein 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc05164  Influenza A
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100400015 (HNRNPUL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA_33 SPRY SAP AAA_18 SRP54
Motif
Other DBs
NCBI-GeneID: 100400015
NCBI-ProteinID: XP_002762199
Ensembl: ENSCJAG00000020106
UniProt: F7BZ79
LinkDB All DBs
Position
22
AA seq 854 aa AA seqDB search
MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALEAEEPDDERELEADDEPGRPGHI
NEEVETEGGSELEGTAQPPPPGLQPHAEPGGYSGPDGHYAMDNISRQNQFYDTQVIKQEN
ESGYERRPLEMEQQQAYRPEMKAEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRG
RGYFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFKVARDRSSGYPLTIEGFA
YLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPF
SYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQK
EALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTVGPKSKAE
CEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVL
IQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKD
RTIKRTDEEGKDVPDHAVLEMKANFTLPDVGDFLDEVLFIELQREEADKLVRQYNEEGRK
AGPPPEKRFDNRGGGFRGRGGGGGFQRYDNRGPPGGNRGGFQNRGGSSGGGNYRGGFNRS
GGGGYNQNRWGNNSRDNNNSNNRGSYNRAPQQQPPPQQPPPPQPPPQQPPPPPSYSPARN
PPGATTYNKNSSIPGSSANTSTPTVSSYSPPQPSYSQPPYNQGGYSQGYTAPPPPPPPPP
AYNYGSYGGYNPAPYTPPPPPTAQTYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDY
GSYSGNTQGGTSTQ
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgcgccgtctgaaggtgaacgaacttcgcgaggagctgcagcgccgcggcctg
gacactcgaggcctcaaggccgagcttgctgagcggctgcaggcggcgttggaggccgag
gagcctgacgacgagcgggagctcgaggccgacgacgaaccggggcgacctgggcacatc
aacgaggaggtcgagaccgaggggggctccgagctggaggggaccgcgcagccaccgccg
cccgggctgcagccgcacgcggagcccggcggctactcggggccggacggacattatgcc
atggacaatatttccaggcagaaccaattctacgatacccaagtcatcaaacaagaaaac
gagtcaggctacgagaggagaccactggaaatggaacagcagcaggcttatcgcccagaa
atgaaggcagagatgaagcaaggagcacccaccagcttcctcccacctgaagcttctcaa
ctcaagccagacaggcagcaattccagagtcggaagaggccttatgaagaaaaccggggg
cgagggtacttcgagcaccgagaggataggaggggccgctctcctcagcctcctgctgaa
gaggatgaagatgactttgatgatacccttgttgctattgacacatataactgcgacctc
cacttcaaggtggcccgagatcggagtagtggctatccactcacaattgagggctttgca
tacctgtggtcaggagcgcgtgccagctatggggtcagaaggggccgtgtgtgctttgag
atgaagattaatgaggaaatctctgtgaagcaccttccatctacagagcctgacccccac
gtggtccgtatcggatggtccctggactcctgcagcacccagctaggcgaagagcctttc
tcctatggctatggaggcactgggaagaagtccaccaatagccggtttgaaaactacgga
gacaagtttgcagagaacgatgtgattggctgctttgcggactttgaatgtggaaatgac
gtggaactttcctttaccaagaatggaaagtggatgggcattgccttccgaatccaaaag
gaagccttggggggtcaggccctctatcctcatgtcctggtgaagaattgcgcagtggag
ttcaacttcggacagagggcagagccctactgttctgtcctcccagggtttaccttcatc
cagcaccttccccttagtgagcggattcggggcaccgttggaccaaagagcaaggcagaa
tgtgagattctgatgatggtgggcctgcctgctgctggcaagaccacatgggccatcaaa
catgcagcctccaacccttccaagaagtacaacatcctgggtaccaatgccatcatggat
aagatgcgggtgatgggcctacgccggcagcggaactatgctggccgctgggatgtcctc
atccagcaggccacccagtgcctcaaccgcctcatccagattgctgcccgcaagaaacgc
aactatatcctagatcagacaaatgtttatgggtcagcccagagacgaaaaatgagacca
tttgaaggcttccagcgcaaagctattgtcatttgtcccactgacgaggacctaaaagac
cgaacaataaagagaaccgacgaggaagggaaggatgtcccagaccatgcggtcttagaa
atgaaagccaacttcacattgccagatgttggggacttcctggatgaggttctgttcatt
gagctgcagcgagaggaagcggacaagctagtgaggcagtacaatgaggaaggccgcaag
gctgggccaccccctgaaaagcgctttgacaaccgaggtggtggcttccggggccgcggg
ggtggcggtggcttccagcgctatgacaaccgaggaccccctggaggcaaccgtggtggc
ttccagaaccgagggggaagcagtggaggaggcaactaccgaggaggtttcaaccgcagt
ggaggtggtggctataaccagaaccgctggggtaacaacagccgggataacaacaactcc
aacaacagaggcagctacaaccgggctccccagcaacagccaccaccacagcagcctccg
ccaccacagccaccaccccagcagccaccgccaccacccagctacagcccagctcggaac
cccccaggggctaccacctacaataagaacagcagcatccctggctcaagcgccaatacc
agcacccccactgtcagcagctacagccctccacagccgagttacagccagccaccctac
aaccagggaggttacagccagggctacacagccccaccgcctccacctccaccaccacct
gcctacaactatgggagctacggcggttacaacccagccccctataccccaccaccaccc
cccaccgcacagacctaccctcagcccagctataaccagtatcagcagtatgcccagcag
tggaaccagtactatcagaaccagggccagtggccaccatactacgggaactatgactac
gggagctactctgggaacacacagggtggcacaagcacacagtag

DBGET integrated database retrieval system