KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400023
Entry
100400023         CDS       T03264                                 

Gene name
MAPK7
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04540  Gap junction
cjc04657  IL-17 signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04912  GnRH signaling pathway
cjc04921  Oxytocin signaling pathway
cjc05206  MicroRNAs in cancer
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100400023 (MAPK7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100400023 (MAPK7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100400023 (MAPK7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100400023 (MAPK7)
   04921 Oxytocin signaling pathway
    100400023 (MAPK7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100400023 (MAPK7)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100400023 (MAPK7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100400023 (MAPK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100400023 (MAPK7)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100400023 (MAPK7)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100400023 (MAPK7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH Rrn6
Other DBs
NCBI-GeneID: 100400023
NCBI-ProteinID: XP_002747912
Ensembl: ENSCJAG00000001277
UniProt: F7II28
LinkDB
Position
5
AA seq 814 aa
MAELLKEEDSEDGSAEPPGPVKGEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCVMESPPPALPACPGPAPDTIDLTLQPPAAASEPAPPKKEGAISDNTKAALK
AALLKSLQSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPPAPAPTSVLTPAPAPTPTPAQP
TSPPPGPIALPAGPQSQPAGSTSGPVPQPACPPPGPAPHPTGLPRPISVPASLQVATSTS
LLAPQSLVPPPGLPGSSTPGVLPYFPSGLPPPDGGGAPQSSMSESPDVNLVTQQLSKSQV
EDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGLADGPQDGQADSASLSASLLADWL
EGHGMNPADIESLQREIQMDSPMLLADLPDLQDP
NT seq 2445 nt   +upstreamnt  +downstreamnt
atggccgagctcctgaaggaggaagacagcgaggacggctctgcggagccccccgggccc
gtgaagggcgaacccgcccacactgctgcctctgtagcggccaagaacctggcactgctt
aaagcccgctccttcgatgtgacctttgacgtgggcgacgagtacgagatcattgagact
ataggcaacggggcctacggagtggtgtcctccgctcgccgccgcctcaccggccagcag
gtggccatcaagaagatccctaatgctttcgatgtggtgaccaatgccaagcggaccctc
agggagctgaagatcctcaaacacttcaagcatgacaacatcatcgccatcaaggacatc
ctgaggcccactgtgccctacggcgaattcaaatctgtctatgtggtcctggacctgatg
gagagtgacctgcatcagatcatccactcctcacagcccctcacgctggaacacgtgcgg
tacttcctgtaccaactgctgcggggcctgaagtacatgcactcggctcaggtcatccac
cgtgacctcaagccctccaacctattggtgaatgagaactgtgagctcaagattggtgac
tttggtatggctcgtggcctgtgtacctcacccgctgaacatcagtacttcatgactgag
tatgtggccactcgctggtaccgtgcccccgagctcatgctctctttgcatgagtacaca
caggctattgacctctggtctgtgggctgcatctttggtgagatgctagcccggcgccag
ctcttcccgggcaaaaactacgtacaccagctacagctcatcatgatggttctgggtacc
ccatcaccagctgtgattcaggctgtgggggctgagagggtacgggcctatatccagagc
ttgccaccacgccagcctgtgccctgggagacagtgtatccaggtgccgaccgccaggcc
ctatcactgctgggtcgcatgctgcgttttgagcccagcgcccgcatctcagcagctgct
gcccttcgccaccccttcctagccaagtaccatgaccctgatgatgagcctgattgtgcc
ccgccctttgactttgcctttgaccgagaagccctcactcgggagcgcattaaagaggcc
attgtggctgagattgaggacttccatgcaaggcgcgagggcatccgccaacagattcgc
ttccagccttctctgcagcctgtggctagtgagcctggctgtccagatgttgagatgcct
agcccctgggctcccagtggggactgtgtcatggagtctcccccaccagccctgccagcg
tgccccggccctgcacctgacaccattgatctgaccctgcagccacccgcagcagccagt
gagcctgccccaccgaagaaagagggtgccatctcagacaacactaaggctgctctcaaa
gctgcgctgctcaagtccttgcagagccggctcagagatggccccagcgcacccctggag
gctcctgagcctcggaagccagtgacagcccaggagcgccagcgggagcgggaggagaag
cggcggcggcggcaagagcgagccaaggagcgggagaaacggcggcaggagcgagagcga
aaggaacggggggctggagcctctgggggcccctccactgaccccctggctggactagta
ctcagtgacaatgaccgaagcttgttggaacgctggactcgaatggcccggcccccagcc
ccagcccccacctctgtgctaacccctgccccagcaccaacgccaaccccagcccagcct
accagccctccccctggccctatagccctacccgctggcccccaatcacagcctgcaggt
tccacctctggccctgtaccccagcctgcctgcccaccccctggccctgcaccccacccc
actggccttcctagacctatctctgtccctgcatcactccaggttgccacttctaccagc
ctcctggctccccagtcacttgtgccgccccctgggttgcctggctccagcaccccagga
gttttgccttacttcccatctggcctgccacctccagatggagggggagcccctcagtct
tccatgtcagagtcacctgatgtcaacctggtgacccagcagctatctaagtcacaggtg
gaggaccccctgccccctgtgttctcaggcacaccaaagggcagtggggctggctacggt
gttggttttgacctggaggaatttttaaaccagtctttcgacatgggcttggctgatggg
ccacaggatggccaggcagattcagcctcactctcagcctccctgcttgctgactggctc
gaaggccatggtatgaaccctgccgatattgagtccctgcagcgtgagatccagatggac
tccccaatgctactggctgacctgcctgacctccaggacccctga

DBGET integrated database retrieval system