KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400029Help
Entry
100400029         CDS       T03264                                 

Gene name
AMOT
Definition
(RefSeq) angiomotin
  KO
K16819  angiomotin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04390  Hippo signaling pathway
cjc04530  Tight junction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100400029 (AMOT)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100400029 (AMOT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Angiomotin_C DUF2162
Motif
Other DBs
NCBI-GeneID: 100400029
NCBI-ProteinID: XP_017823786
Ensembl: ENSCJAG00000007004
LinkDB All DBs
Position
X
AA seq 1094 aa AA seqDB search
MRNSEEQPSGGTTVLQRLLQEQLRYGNPSENRSLLAIHQQATGNGPPFPSGSGNPVPQSD
VLSPQDHHQQLVAHAARQEPQGQEIQSENIIMEKQLSPRMQNNEELPTYEEAKVQSQYFR
GQQHASVGAAFYVTGVTNQKMRTEGRPSVQRLNPGKMHQDEGLRDLKQGHVRSLSERLMQ
MSLATSGVKAHPPVTSAPLSPPQPNDLYKNPTSSSEFYKAQGPLPNHHSLKGMEHRGPPP
EYPFKGMPPQSVVCKPQEPGHFYSEHRLNQPGRTEGQLMRYQHPPEYGAARPTQDISLPL
SARNSQPHSPTSSLTSGGSLPLLQSPPSTRLSPGRHPLVPNQGDHSAHLARPQQHFLPNQ
AHQGDHYRLSQPGLSQQQQQQQQQHHHHHHHQQQQPPPQQQPGEAYSAMPRAQPTSASYQ
PMPADPFAIVSRAQQMVEILSDENRNLRQELEGCYEKVARLQKVETEIQRVSEAYENLVK
SSSKREALEKAMRNKLEGEIRRMHDFNRDLRERLETANKQLAEKEYEGSEDTRKTISQLF
AKNKESQREKEKLEAELATARSTNEDQRRHIEIRDQALGNAQAKVVKLEEELKKKQVYVD
KVEKMQQALVQLQAACEKREQLEHRLRTRLERELESLRIQQRQGSCQPTSVSEYSAAALM
ELLREKEERILALEADMTKWEQKYLEENVMRHFALDAAATVAAQRDTTVISHSPNTSYDT
ALEARIQKEEEEILMANKRCLDMEGRIKTLHAQIIEKDAMIKVLQQRSRKEPSKTEQLSC
MRPAKSLMSISNAGSGLLSHSSTLTGTPIMGKKSETTKKITYYFLTSVPLSFVGILLGGD
YRTEYVSSTPSPVPPSTPLLSAHSKTGSRDCSTQTERGTESNKTAAVAPISVPAPAAAAA
TAAAITATAATITTTMVAAAPVAAAATAAPAAAAVAATPSPATAAAIAAVSPAAAGQIPA
AASVAPPAAAVPSLAAAAVQVAPAAPTPVPAPALVPVPAPAAAQASAPAQTQAPTSTPAA
APTPAPTPTPAVAQAEAPASPATGPGPHRLSTPSLTCNPDKTDGPVFHSNTLERKTPIQI
LGQEPDAEMVEYLI
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
atgagaaattctgaagaacagccaagtggagggaccacagtattgcagcgtctgctacaa
gagcagcttcgctatggcaatcctagtgagaatcgcagcctacttgccatacaccagcaa
gccacagggaatggccctcctttccccagtggcagtgggaacccagtccctcagagtgat
gtgttgagtccccaagaccaccaccaacagctagtggctcatgcagctcgacaagaaccc
caggggcaggaaatccagtcagaaaacatcatcatggagaagcagctatctcctcgaatg
cagaataatgaagaactcccgacctatgaagaagccaaggtccagtcccagtactttcgg
ggccaacagcatgccagtgttggagctgccttctatgtcactggagtcaccaaccagaag
atgaggaccgagggacgcccatcagttcagcggctcaatcctggaaagatgcaccaagat
gaaggactcagagaccttaagcaagggcatgtccgttccttgagtgaacgactaatgcag
atgtcactggccaccagtggagttaaggcccatccacctgttaccagtgctcccctctcc
ccaccacaacccaatgacctctacaagaatcccacaagttccagtgaattctacaaggcc
caagggccacttcctaaccaccatagcctgaagggcatggaacaccgaggccccccacca
gagtatcccttcaagggcatgccaccccagtctgtagtgtgcaagccccaagagccaggg
cacttctatagtgagcatcgcctgaaccagccagggagaacagaggggcaactgatgagg
tatcagcatccccctgagtatggagcagccaggccaacgcaggacatctcattgccattg
tcagccaggaactctcagcctcacagccctacttcttctctgacctctggggggtccctg
cccttgctacaatctccaccatccactagattgtctcctggccgacaccccttggtccca
aaccagggagaccattcagctcacctggctaggccgcagcagcatttccttcctaatcag
gctcaccagggggatcattaccgtctctcccaacctggcctgagtcagcaacagcagcaa
cagcagcaacagcaccaccatcaccatcaccaccaacagcagcagccgccgccacaacag
cagccaggagaagcctattcagctatgcctcgggctcagccaacctctgcttcttatcag
ccaatgccagcagacccttttgccattgtttccagagcccagcagatggttgagatcctc
tcagatgaaaacaggaacttgcggcaggagttggaaggatgctatgagaaggtggccaga
ctgcagaaggtggagacagaaatccagcgagtctcagaggcatatgagaaccttgtgaag
tcatcctctaaaagagaggccctagagaaagccatgagaaacaagctagagggtgagatt
cggaggatgcatgacttcaacagggatctgagagagcgtctagagactgccaacaagcag
cttgcagagaaggaatatgaggggtcagaggacaccagaaaaaccatctcacagctcttt
gcaaaaaataaagaaagccagcgtgagaaggagaagctggaagcagagctggccactgcc
cgttctaccaatgaggaccaaagacgacacatcgaaatccgagaccaggccctgggtaat
gcccaggccaaggtggtaaagctggaagaagagctgaaaaagaagcaagtgtacgttgac
aaggtggagaagatgcagcaggcccttgtacaactccaggcagcatgtgaaaaacgtgag
cagctagagcaccgtctccggacacgactagagagggaactggaatccctgagaattcag
cagcgtcagggcagctgtcagcccaccagcgtttcagaatacagcgccgctgcgctgatg
gagctccttcgggagaaagaggagaggattctggctctggaagctgatatgacaaagtgg
gagcagaagtatttggaggagaatgtgatgagacatttcgctctggatgctgctgcaact
gtggctgctcagagggacacaacagtcatcagtcactctcctaacaccagctatgacaca
gctctagaagctcgcatccagaaagaggaggaagaaatcttgatggccaataagcgttgc
cttgacatggagggcaggattaagaccctccatgcccagattattgagaaggatgccatg
atcaaagtactccagcagcgttcccgaaaggagccgagtaagacagagcagctgtcgtgc
atgaggccagcgaagtctctgatgtccatttccaatgctggatcaggcttgctctcccac
tcatctaccctgactggcacccccatcatgggaaaaaaaagcgagacgacaaagaaaatc
acctattattttctaacgtctgtccctctttcatttgtaggcattctcctgggtggagac
taccgtactgaatatgtctcttccacaccctcgcctgtgcccccctcgactcccctgctc
tcggctcattccaagacaggcagccgagactgcagcacccaaactgaacgtggaacggaa
tcgaacaaaaccgcggctgttgctcccatctctgttcctgctccagctgctgctgctgcc
actgctgctgccatcactgccactgctgccaccatcaccaccacaatggtagctgctgct
ccagttgctgctgctgctactgctgctccagctgctgctgctgttgctgctaccccatct
ccagcaactgctgctgctattgctgctgtttctccagctgctgctggtcagattccagct
gctgcctctgttgctcctcctgctgctgctgttccttctcttgctgctgctgctgttcag
gttgctccagctgctccgactccggttccagctccggctctggttccggttccagctcca
gcagcggctcaggcttctgctcctgctcagactcaagcaccaacttcaactccggctgcg
gctccaactccagctccaactccaactccagctgtggctcaggctgaggctcctgcaagt
ccagctaccggtcctggaccacatcgtttgtctacaccaagtttgacctgcaatcctgac
aaaacggatggccctgtgttccactccaatactctggaaagaaaaactcccattcagatc
ctgggacaagagcctgatgcagagatggtggaatatctcatctaa

DBGET integrated database retrieval system