KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400212Help
Entry
100400212         CDS       T03264                                 

Gene name
GSTO2
Definition
(RefSeq) glutathione S-transferase omega 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00480  Glutathione metabolism
cjc00980  Metabolism of xenobiotics by cytochrome P450
cjc00982  Drug metabolism - cytochrome P450
cjc00983  Drug metabolism - other enzymes
cjc01100  Metabolic pathways
cjc01524  Platinum drug resistance
cjc05200  Pathways in cancer
cjc05204  Chemical carcinogenesis
cjc05225  Hepatocellular carcinoma
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100400212 (GSTO2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100400212 (GSTO2)
   00982 Drug metabolism - cytochrome P450
    100400212 (GSTO2)
   00983 Drug metabolism - other enzymes
    100400212 (GSTO2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100400212 (GSTO2)
   05204 Chemical carcinogenesis
    100400212 (GSTO2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100400212 (GSTO2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100400212 (GSTO2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100400212 (GSTO2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100400212 (GSTO2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100400212 (GSTO2)
Transporters [BR:cjc02000]
 Other Transporters
  Pores ion channels [TC:1]
   100400212 (GSTO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 Glutaredoxin GST_C
Motif
Other DBs
NCBI-GeneID: 100400212
NCBI-ProteinID: XP_002756474
Ensembl: ENSCJAG00000018486
LinkDB All DBs
Position
12
AA seq 250 aa AA seqDB search
MLRRLETLPENAARALGKGSQPPGPVPEGLIRIYSMRFCPCSHRIRLVLRAKGIRHEVVN
INLKNKPEWYYTKHPFGQIPVLETSQCQLIYDSVIACEYLDDAYPGRKLFPYDPYQRAWQ
KMLLELFCKVPHLTKKCLVALRCGRECTGLKAALHQEFCNLEEILEYQNTTFFGGACISM
IDYLLWPWFERLDVYGIADCLSHMPALRLWISAMKQDPTVCALLTDKCVFQGFLNLYFQD
NPDAFDFGLD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgctcagacgcctggagaccctgcctgagaatgcggccagggccttggggaaaggaagc
cagcccccagggccagtcccagagggcctgatccgcatctacagcatgaggttctgcccc
tgttctcacaggatccgcctcgtcctccgagccaaaggcatcagacacgaagtggtcaac
attaacctgaaaaacaagcctgaatggtactacacaaagcacccttttggccaaattcct
gtcctggagaccagccaatgtcaactgatctatgactctgttatcgcttgtgagtacctg
gatgacgcttatccaggaaggaagctgtttccatatgacccttatcaacgagcttggcaa
aagatgttattggagctattttgtaaggtcccacacttaaccaagaagtgcctggtagcg
ttgagatgtgggagagaatgcactggcctgaaggcagccctgcatcaggagttctgcaac
ctggaagagattcttgagtatcagaacaccaccttctttggtggagcctgtatatccatg
attgattacctcctttggccctggtttgagcggctggatgtgtatgggatagcggactgc
ctgagccacatgccagccctgcggctctggatatcagccatgaagcaggaccccacagtc
tgtgcccttctcacggataagtgcgttttccagggtttcttgaatctctattttcaggac
aaccctgatgcctttgactttgggctggactga

DBGET integrated database retrieval system