KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400483Help
Entry
100400483         CDS       T03264                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00020  Citrate cycle (TCA cycle)
cjc00190  Oxidative phosphorylation
cjc01100  Metabolic pathways
cjc01200  Carbon metabolism
cjc04714  Thermogenesis
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05010  Alzheimer disease
cjc05012  Parkinson disease
cjc05016  Huntington disease
Module
cjc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cjc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cjc_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100400483 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100400483 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100400483 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    100400483 (SDHA)
   05012 Parkinson disease
    100400483 (SDHA)
   05016 Huntington disease
    100400483 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100400483 (SDHA)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100400483 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 100400483
NCBI-ProteinID: XP_008990539
Ensembl: ENSCJAG00000017583
UniProt: U3FBY1
LinkDB All DBs
Position
2
AA seq 664 aa AA seqDB search
MSGVRRLSRLLSAQRLALAKAWPAVSPTGTRGFHFTVDGNKRASAKVSESISAQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTQDGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIE
DGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
KDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDK
VPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCEKIS
KLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVR
IDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVGTGKVTLEYRPVIDKTLNEADCTSVPPA
IRSY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtccggaggctgtcacggctgctgagcgcccagcgcctggcgctggccaag
gcatggccagcagtgtcaccaacgggaacccgaggttttcacttcactgtggatgggaac
aagagggcatctgctaaagtttcagaatccatttctgctcagtatccagtagtggaccat
gaatttgatgccgtggtggtgggcgctggaggggcaggcctgcgagctgcgtttgggctt
tctgaggcagggtttaatacagcatgtgttaccaagctgtttcccaccaggtcacacact
gttgcagcccagggaggaatcaatgctgctctggggaacatggaggaggacaactggagg
tggcatttctacgacaccgtgaaaggctccgactggctgggggaccaggatgccatccac
tacatgacagagcaggcccctgccgccgtggtcgagctagaaaattatggcatgccgttt
agcagaacccaagatgggaagatttatcagcgtgcgtttggtggacagagcctcaagttt
ggaaagggcgggcaggcccatcggtgctgctgcgtggctgatcggactggccactcgcta
ctgcacaccttatatggaaggtctctgcgatatgataccagctattttgtggagtatttt
gccttggatctcctgatggagaatggggagtgccgtggtgtgattgcactgtgcatagaa
gatgggtccatacatcgcataagagcaaagaacactgttgttgctacaggaggctacggg
cgcacctacttcagctgcacgtctgcccacaccagcaccggtgatggcacagccatggtc
accagggcaggccttccttgccaggacctcgagtttgtccagttccaccccacaggcatc
tatggtgctgggtgtctcatcacagaaggatgtcgtggagagggaggcattctcattaac
agtcagggcgaaaggtttatggagcgatacgcccccgttgcgaaggacctggcatccaga
gatgtggtgtctcggtccatgactctggagatccgcgaaggaagaggctgtggccctgag
aaagatcacgtctacctgcagctgcaccacctgcctccagagcagctggccacgcgcctc
cctggcatttcggagacagccatgatctttgctggcgtggacgtcacgaaggagccgatc
cctgtgctccccactgtgcattataacatgggcggcattcccaccaactacaagggacag
gtcctgaggcacgtgaatggccaggatcagatcgtgcctggcctgtacgcctgtggggag
gccgcctgcgcctcagtccatggtgccaaccgtctcggggcaaactcgctcttggacctg
gttgtctttggccgggcctgtgccctgagcatcgaagagtcatgcaggcctggagataaa
gtccctccaattaaaccaaatgctggggaagaatctgtcatgaatcttgacaaattgaga
tttgctgacggaagcataagaacatcggaactacgactcagcatgcagaagtcaatgcaa
aatcatgctgccgtgttccgtgtgggaagtgtgctgcaagaaggttgcgagaaaatcagc
aagctctacggagacctgaagcacctgaagacgtttgacaggggaatggtctggaacacg
gacctggtggagaccctggagctgcagaacctgatgctgtgtgcgctgcagaccatctac
ggagcagaggcgcggaaggagtcgcggggcgcgcacgccagagaagactacaaggtgcgg
attgatgagtacgattactccaaacccatccaggggcaacagaagaagccctttgaggag
cactggaggaagcacaccctgtcctatgtggacgtgggcactgggaaggtcactttggaa
tatagacctgtaatcgacaaaactttgaacgaggctgactgcacctccgttcccccggcc
attcgctcctactga

DBGET integrated database retrieval system