KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400779
Entry
100400779         CDS       T03264                                 

Gene name
GLI3
Definition
(RefSeq) GLI family zinc finger 3
  KO
K06230  zinc finger protein GLI3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04340  Hedgehog signaling pathway
cjc05200  Pathways in cancer
cjc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100400779 (GLI3)
   04024 cAMP signaling pathway
    100400779 (GLI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100400779 (GLI3)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100400779 (GLI3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100400779 (GLI3)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    100400779 (GLI3)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 100400779
NCBI-ProteinID: XP_002751401
Ensembl: ENSCJAG00000007690
LinkDB
Position
8
AA seq 1578 aa
MEAQSHSSTATEKKKVENSIVKCSTRADVSEKAVASSTTSNEDESPGQTYHRERRNAITM
QPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHLAEPSVPYRGTVFAMDPRNGYMEP
HYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHMPSALSSSPTYPDLPFIRISPHR
NPAAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISATRGLSPTDAPHAGVSPAEYYHQ
MALLTGQRSPYADIIPSAATAGTGAIHMEYLHAMDSTRFPSPRLSARPSRKRTLSISPLS
DHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYSSAPVSLHMH
QQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQNKPTSE
SAVSSTGDPMHSKRSKIKPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYET
NCHWEGCTREFDTQEQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRH
TGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRT
HSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDIHPRPPPPRDSGSHS
QSRSPGRLTQGALGEQQDLSNTTSKREECLQVKTVKAEKPMTSQPSPGGQASCSSQQSPI
SNYSNSGLELPLTDGGSIGDLGAIDETPIMDSTISTATTALALQGRRNPAGTKWMEHVKL
ERLKQVNGMFPRLNPILPPKAPAVSPLIGNGTQSNNTCSLGGPMTLLPGRSDLSGVDVTM
LNMLNRRDSSASTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPIST
DASRRSSEASQGDGLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMERMSLKTRLALL
GEPLEPGVALPPVHVPRRCSDGGAHGYGRRHLQPHDAPGHGVRRASDPVRTGSEGLALPR
VPRFSSLSSCNPQAMAQSTEKRSLVLQNYTRPEGGQPRNFHSSPCPPSITENVTLESLSM
DADANLNDEDFLPDDVVQYLNSQNQAGYEQHFPSALPDESKVPHGPGDFDTPGLPDSHAG
QQFHALEQPCPEGSKTDQPIQWNEVSSGSADLSSSKLKCGPRPAMPQTRAFGFCNGMVVH
PQNPLRSGPAGGYLGENSSPYGGPEHVVLHSSPGSGTSGNAFHEQPYKALQYGNCLNRQP
VAPGALDAACGAGIQASKLKSTPMQGSGAPLNFSLPVVPNESAGSTVNGMQTQDPVGQGY
LAHQLLGNSMQHQGAGRPGQQMLGQVSATSHINIYQGPESCLPGAHGMGSQPSSLAVVRG
YQPCASFGGSRCQAVPRGSLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYSGQ
FYDQTVGFSQQDTKAGSFSISDASCLLQGTSAKNSELLSPGANQVTSTVDSLDSHDLEGV
QIDFDAIIDDGDHSSLMSGALSPSIIQNLSHSSSRLTTPRASLPFPALSMSTTNMAIGDM
SSLLTSLAEESKFLAVMQ
NT seq 4737 nt   +upstreamnt  +downstreamnt
atggaggcgcagtcccacagctccacggccactgaaaagaaaaaagttgagaattccata
gtgaagtgctccactcgagcagatgtgagtgagaaagccgttgcctccagcaccacttct
aatgaggatgaaagtcctggacagacttatcacagagagagaagaaacgcaatcactatg
cagccacagaacgtgcaggggctcagcaaagtcagtgaggagccttcaacatcaagtgac
gagagggcctcattgatcaagaaggagatccatgggtcgctgccacacctggcggagccc
tctgtgccgtaccgggggacggtgtttgccatggaccccaggaatggttacatggagccc
cactaccatcctcctcatcttttccctgccttccatcctcctgtaccaattgatgccaga
catcatgagggccgttaccattacgatccgtctccgattcctccattgcatatgccttct
gccttatctagtagcccgacctatccggacctgcccttcattaggatctccccgcaccgg
aaccccgctgccgcttccgagtctcccttcagccctccgcatccctacattaatccctac
atggactatatccgctccttgcacagcagcccttcgctctccatgatctcagcaactcgt
gggctgagccctacagacgctccccatgcaggagtcagcccagcagagtactatcatcag
atggccctgctaaccggccagcgcagcccctatgcagacattattccctcggctgccact
gccggcactggggccatccacatggaatatcttcacgctatggatagcaccagattcccc
agccccaggctgtcagccaggccgagccgaaaacgtacactgtccatatcaccgctgtcc
gatcatagctttgaccttcagaccatgataaggacgtctcccaactccttggtcacaatt
ctcaataattcccgtagcagctcttcagcaagtggctcctatggtcacttatctgcaagt
gcaatcagccctgccttgagcttcacctactcttctgcgcccgtctctctccacatgcat
cagcagatcctaagccgacagcagagcttaggttcagcctttggacacagccctccactc
atccaccctgccccaacttttccaacacagaggcctattccagggatccctacggttctg
aaccccgtccaggtcagctccggtccttccgagtcctcacagaacaaacccacgagtgag
tccgcagtgagcagcactggtgacccgatgcacagcaagaggtccaagatcaagccggat
gaagacctccccagcccaggggctcgggggcagcaggaacagccggaaggcacaaccctt
gtcaaggaggaaggggacaaagatgaaagcaaacaggagcccgaagtcatctatgagacg
aactgccactgggaaggctgcacgagggagttcgacacccaagagcagcttgtgcaccat
ataaataatgaccatatccatggagagaagaaggagtttgtgtgcaggtggctggactgc
tcaagagagcagaaacccttcaaagcccagtatatgctggtagtacatatgagaagacac
acgggcgagaagcctcacaaatgcacttttgaaggttgcacaaaggcctactcgagacta
gaaaacttgaaaacacacttgagatctcacactggagagaaaccatatgtctgtgagcac
gaaggttgcaacaaggctttctcaaatgcctctgatcgcgccaagcaccaaaacagaacg
cattccaatgagaaaccatatgtgtgcaaaatcccgggctgcactaagcgttacacagac
ccaagctccctccggaaacacgtgaagacagtgcacggcccagaggctcatgtcaccaag
aagcagcgaggagatatccatcctcggcccccacccccgagagattccggcagccattca
cagtccaggtcgcctggcaggctgactcagggagccctcggtgagcagcaggacctcagc
aacactacctcaaagcgggaagaatgcctccaggtgaaaaccgtcaaggcagagaagccc
atgacatctcagccaagccctggtggtcaggcttcatgcagcagccagcagtcccccatc
agcaactattccaacagtgggctcgagcttcctctgaccgacggaggtagtataggagac
ctcggtgccatcgatgaaaccccaatcatggactcgaccatttccactgcaaccacagcc
ctcgctttgcaaggcaggagaaacccggcagggaccaagtggatggagcacgtaaaacta
gaaaggctaaaacaagtgaatggaatgtttccgcgactgaaccccattctaccccctaaa
gcccctgcagtctctcctctcataggaaatggcacacagtccaacaacacctgcagcttg
ggtgggcccatgacacttctcccgggcagaagcgacctctctggggtggacgtcaccatg
ctgaacatgctcaacaggagggacagcagcgccagcaccatcagctcggcctacctgagc
agccgccgctcctcggggatctcgccctgcttctccagccgccgctccagcgaggcgtcg
caggccgagggccggccgcagaacgtgagtgtggccgactcctacgacccgatctccact
gacgcctcgcgccgctccagcgaggccagccagggcgacggcctgcccagcctgctcagc
ctcacgcccgcccagcagtaccgcctcaaggccaagtacgcggcggccacgggcggacca
ccgcccacgcccctgcccaacatggagaggatgagcctgaagacgcgcctggcgctgctc
ggggaacccctcgagcccggcgtggccctgcctcccgtccacgtcccgaggaggtgcagc
gacgggggagcccacggctacgggcggcgccatctgcagccgcacgacgcaccgggccat
ggggtgaggagagccagcgaccccgtgcgcacgggctccgagggcctggccctgccccgg
gtgccgcgattcagcagcctcagcagctgcaacccccaggcgatggcccagtccacggag
aagcgcagcctcgtgcttcagaattacacacggcccgagggcggccagccccgaaacttc
cactcgtccccgtgtcctcctagcatcaccgagaatgtcaccctggagtccctgagcatg
gacgctgatgccaacttgaacgatgaggatttcctgccggacgacgtggtgcagtattta
aattcccagaatcaagcagggtacgagcagcacttcccgagcgccctcccggatgagagc
aaagtgccgcacgggcccggtgactttgacacgcccggcctgccagacagccacgcgggc
cagcagttccatgccctcgagcagccctgccccgagggcagcaaaacggaccagcccatc
cagtggaatgaggtcagctccggaagcgccgacctgtcctcctccaagctcaagtgtggc
ccgcggcccgccatgcctcagactcgcgcctttgggttctgcaatggcatggtggtccac
ccacagaaccctctgaggagcgggcccgctgggggctatctcggggagaacagcagcccc
tatggtggcccagagcacgtggtgctgcacagcagccccggaagtggcaccagtggaaat
gccttccatgaacagccctacaaggccctgcagtatggaaactgtctcaacaggcagcca
gtggcccctggtgcgctagacgctgcctgtggggcagggattcaagcctcaaagctgaaa
agtacccccatgcaagggagcggggccccgctgaatttcagcctgccagtagtgccaaat
gagtcagctggcagcacggtaaatggcatgcagacccaggacccggtgggacaggggtac
ctggctcaccagctccttggcaacagcatgcagcaccagggggcaggccgtcccggtcag
cagatgcttgggcaggttagtgctacctcacatatcaacatctatcaaggtccagagagc
tgcctgccaggggctcacggcatgggcagccagccgtcaagcttggcagtcgtcaggggc
taccagccatgtgccagctttgggggcagcaggtgccaggctgtgccaaggggcagcctt
gctctgcagtcagggcagctcagtgacacaagtcagacctgcagggtgaatggcatcaag
atggagatgaaagggcagccccatcctctgtgctctaatctgcagaattactctggtcag
ttctatgaccaaaccgtgggcttcagtcagcaagacacgaaagctggttcattctccatt
tcagacgccagctgcctgctacaggggaccagcgccaaaaactctgagttactttcccca
ggtgctaatcaggtgacaagcacagtggacagcctcgacagccatgacctggaaggggta
cagattgatttcgatgccatcatagatgatggggaccactccagcctgatgtcaggggcc
ctgagcccaagtatcattcagaacctttcccatagctcctcccgtctcaccacgcctcgg
gcatccctcccgttcccagcgctgtccatgagcaccaccaacatggctatcggggacatg
agttctttgctgacctccctagcggaagaaagcaaattccttgcagttatgcaatag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401526
Entry
100401526         CDS       T03264                                 

Gene name
GLI1
Definition
(RefSeq) GLI family zinc finger 1
  KO
K16797  zinc finger protein GLI1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04340  Hedgehog signaling pathway
cjc05200  Pathways in cancer
cjc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100401526 (GLI1)
   04024 cAMP signaling pathway
    100401526 (GLI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100401526 (GLI1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100401526 (GLI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100401526 (GLI1)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    100401526 (GLI1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 IL17
Other DBs
NCBI-GeneID: 100401526
NCBI-ProteinID: XP_002752694
Ensembl: ENSCJAG00000007324
UniProt: F7AEX2
LinkDB
Position
9
AA seq 1106 aa
MFNSMTPPPVSSYGEPCCLRPLPSQGAPSVGTEGLSGLPFCHQANLMSGPHSYGPARETN
SCTEGPLFSSPRSTVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGS
YGHLSIGTMSPSLGFPPQMNHQKGPSPSFGVQPCGPHESSRGGMIPHPQSRGSLPTCQLK
SELDMLVGKCREEPLEGDMSSPNSTGIQDPLLGMLDGREDLEREEKREPESVYETDCRWD
GCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKP
HKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEK
PYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPSLSTVEPKREREG
GPIREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSS
LDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTPVSRRLGPPVSLD
RRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGG
TPPTAASSLDRIGGLPVPPWRSRAEYPGYNPNAGVTRRASDPARAADRPVPARVQRFKSL
GSVHTTPTVGGGGQNFDPHLPTSVYSPQPPSITENAAMDTRGLQEEPEVGTSMMGSGLNP
YMDFPPADTLGYGGPEGAAAEPYGARGPGSLPLGPGPPISYGPNPCPQQASYPDPTQETW
GEFPSHSGLYPGPKALGGAYSQCPRLEHYGQVQVKPEQGCPVGSDTTGLAPCLSAHPDEG
PPHPQPLFSHYPQPTPPQYLQSGPYTQPPPDYLPSEPRPCLDFDSPTHSTGQLKAQLVCN
YVQSQQELLWEDGGREDAPAQEPSYESPKFLGGSQVSPSPAKAPVTTYGPGFGLNLPNHK
SGSYPTPSPCHENFVVGANRASHSAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLG
GGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEAQGLSPPPSHDQGGSSGHTPHHAGP
PNMAVGNMSVLLRSLPGETQFLNSSA
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgttcaactcgatgaccccaccaccagtcagtagctatggcgagccctgctgtctccgg
cccctccccagtcagggggcccccagtgtggggacagaaggactgtctggcctgcccttc
tgccaccaagctaacctcatgtctggcccccacagttatgggccagccagagagaccaac
agctgcaccgagggcccactcttttcttctccccggagtacagtcaagttgaccaagaag
cgggcattgtccatttcaccgctgtcggacgctagcctggacctgcagacggttatccgc
acctcacccagctcccttgtagctttcatcaactcgcgatgcacatccccaggaggctcc
tatggccatctctccattggcaccatgagcccatctctgggattcccaccccagatgaat
caccaaaaagggccctcgccttctttcggggtccagccctgtggtccccatgaatcctcc
cgaggtgggatgatcccacatcctcagtctcggggatccctcccaacttgccagctgaag
tctgagctggacatgctggttggcaaatgccgggaggagcccttggaaggtgatatgtcc
agccccaactccacaggcatacaggatcccctgttggggatgctggatgggcgggaggac
cttgagagagaggagaagcgtgaacctgaatctgtgtatgagactgactgtcgttgggat
ggctgcagccaggaatttgactcccaagagcagctggtgcaccacatcaacagcgaacac
atccatggggagcggaaggagttcgtgtgccactgggggggctgctccagggagctgagg
cccttcaaagcccagtacatgctggtggtgcacatgcgcagacacactggcgagaagcca
cacaagtgcacgtttgaagggtgccggaagtcatactcacgcctcgaaaacctgaagaca
cacctgcggtcacacacgggtgagaagccatacatgtgtgagcatgaaggctgcagcaaa
gccttcagcaatgccagtgaccgagccaagcaccagaatcggacccactccaatgagaag
ccgtacgtgtgtaagctccctggctgcaccaaacgctatacagatcccagctcgctgcgg
aaacatgtcaagacagtgcatggtcctgatgcccatgtgaccaagcggcaccgtggggac
ggccctctacctcgggcaccctccctttccacagtggagcccaagagggagcgggaagga
ggccccatcagggaggagagcagactgactgtgccagagggtgccatgaagccacagcca
agccctggggcccagtcatcctgcagcagtgaccactccccggcaggcagtgcagccaat
acagacagcggtgtggaaatgaccggcaatgcagggggcagcactgaagacctctccagc
ctggatgaggggccttgcattgctggcactggtctgtccactctccgccgccttgagaac
ctcaggctggaccagctgcatcaactccggccaatagggacccggggtctcaaactgccc
agcttgtcccacactggtacccctgtgtcccgccgcctgggccccccagtctctcttgac
cgccgcagtagcagctccagcagcatcagctctgcctatactgtcagccgtcgctcctcc
ctggcgtcccctttcccccctggctccccaccagagaatggagcatcctccctgcctggc
cttatgcctgcccagcactacctgctccgggcaagatatgcttcagccagagggggtggt
accccgcccactgcagcatccagcctggatcggatagggggtcttcctgtgcctccttgg
agaagccgagctgagtatccaggatacaatcccaatgcaggggtcacccggagggccagt
gacccagcccgggctgctgaccgtcctgttccagctagagtccagaggttcaagagcctg
ggctctgtccatacaacacccactgtgggagggggaggacagaacttcgatcctcacctc
cccacctctgtctactcaccacagccccccagcatcactgagaatgcggccatggatact
agagggctacaggaggagccagaagttgggacctccatgatgggaagtggtctgaacccc
tatatggacttcccacctgctgatactctgggatatgggggacctgaaggggcagcagct
gagccttatggagcgaggggtccaggctccctgcctcttgggcctggtccacccatcagc
tatggccccaacccctgtccgcagcaggcctcatatcctgaccccacccaagaaacatgg
ggtgagttcccttcccactctgggctgtacccaggccccaaggctctaggtggagcctat
agccagtgtcctcgacttgaacattatggacaagtgcaagtcaagccggaacagggatgc
ccagtggggtctgacaccacaggactggcaccctgcctcagtgcccaccccgatgagggg
cccccacacccacagcctctcttttcccactatccccagcccactcctccccaatatctc
cagtcaggcccctatacccagccaccccctgattatcttccttcagaacccaggccttgc
ctggactttgattcccccacccattctacagggcagctcaaggctcagcttgtgtgtaat
tatgttcagtctcaacaggaactgctgtgggaggatgggggcagggaagatgccccagcc
caggaaccttcctacgagagtcccaagtttctggggggttcccaggttagcccaagccct
gctaaagctccagtgaccacatatggacctggctttggactcaacttacccaatcacaag
tcaggctcttatcccaccccttcaccatgccatgaaaattttgtagtgggggcaaacagg
gcttcccatagtgcagcagcaccacctcgacttctgcctccattgcccacttgctatggg
cccctcaaagtgggaggcacaaaccccagctgtggccatcctgaggtgggcaggctggga
gggggtcctgccttgtaccctcctcccgaaggacaggtatgtaaccccctggactctctt
gatcttgacaacactcagctggactttgtggctattctggatgaggcccaggggctgagt
cctcctccttcccatgatcaggggggcagctctggacataccccacatcatgctgggccc
cccaacatggctgtaggcaacatgagtgtcttactgagatccctcccgggggagacacaa
ttcctcaactctagtgcctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100413916
Entry
100413916         CDS       T03264                                 

Gene name
GLI2
Definition
(RefSeq) GLI family zinc finger 2
  KO
K16798  zinc finger protein GLI2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04340  Hedgehog signaling pathway
cjc04390  Hippo signaling pathway
cjc05200  Pathways in cancer
cjc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100413916 (GLI2)
   04390 Hippo signaling pathway
    100413916 (GLI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100413916 (GLI2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100413916 (GLI2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100413916 (GLI2)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    100413916 (GLI2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4
Other DBs
NCBI-GeneID: 100413916
NCBI-ProteinID: XP_008997289
LinkDB
Position
6
AA seq 1153 aa
MEHYLRSVHSSPTLSMISAARGLSPADVAQEHLKERGLFGLPAPGTTPSDYYHQMTLVAG
HPAPYGDLLMQSGGAASAPHLHDYLNPVDVSRFSSPRVTPRLSRKRALSISPLSDASLDL
QRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGTLSPAFTFPHPINPVAYQQILSQQRG
LGSAFGHTPPLIQPSPTFLAQQPMALTSVNATPTQLSSSSNCLSDNQNKQSSESAVSSTI
NPVAIHKRSKVKTEPEGLRPASPLALTQEQLADLKEDLDRDDCKQEAEVVIYETNCHWED
CTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPH
KCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKP
YICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDMHLRTPLLKENGDSEAGTEPG
GRASEDSAEASSTSHAVEDCLHVRAIKTESSGLCQSSPGAQSSCSSEPSPLGSAPNNDSG
VEMPGTGPGSLGDLTALDDTPPGADTSALAAPSTGGLQLRKHMTTMHRFEQLKKEKLKSL
KDSCSWAGPTPHTRNTKLPPLPGSGTTFGCPTIWCSYIKAHASGALDEGAGQVYPTESTG
FSENPKLPSPGLHGQRRMXAADSNVSPSAPVLGGCQLGFGAPSSLNKNNMPVQWNEVSSG
TVDALASQVKPPPVPQGNLAVVQQKPAFGQYPGYSPQGLQASPGGLDSTQPHLQLPSGAP
SQGMPRVNYMQQLRQPVAGSQCPGMTTAMSPHACYGQAHPQLSPSTISGALSQFAPSCSS
MPAKPGHLGHPQQTEVAPDPTMMANRHRELGVLNSALAGVPPPHPVQSYPQQSHHLAAPM
SQEGYHQVPSLLPARQPGFIEPQPGPMGVATAGFGLVQPRPPPDPSPAGRHRGVRAAQQQ
LAYARATGHAMAAMPSSQETAEAVPKGAMGTMGSVHPQPPLPDSGPPDHSMLYYYGQIHM
YEQDGGLENLGGCQVTRSQPPQPQACLDNIQPQPLPSPGVNQVSSTVDSQLLEAPQIDFD
AIMDDGDHSSLFSGALSPSLLHNLSQNSSRLTTPRNSLTLPSIPAGISNMAVGDMSSMLT
SLAEESKFLNMMT
NT seq 3462 nt   +upstreamnt  +downstreamnt
atggagcactacctccgttctgtgcacagcagccccacgctctccatgatctctgcagcc
aggggcctcagccccgctgacgtggcccaggagcaccttaaggagaggggtctgtttggc
ctccctgctccaggcaccaccccctcagactattaccaccagatgaccctcgtggcgggc
caccccgcaccttacggggacctgctgatgcagagcgggggtgctgccagcgcaccccat
ctccacgactacctcaacccagtggacgtgtcccgtttctccagccctcgggtgacgccc
cgcctgagccgcaagcgggcgctgtccatctccccgctctcagacgccagcctggacctt
cagcggatgatccgcacctcacccaactcgctggtggcctacatcaacaattcccgcagc
agctcagcggccagcggctcctatgggcacctgtcggcaggcaccctcagcccagccttc
actttcccccaccccatcaaccccgtggcttaccagcagattctgagccagcagaggggt
ctggggtcagcctttggacacacaccacctctgatccagccctcacccaccttcctggct
cagcagcccatggccctcacctccgtcaatgccacgcccacccagctcagcagcagcagc
aactgtctgagtgacaaccagaacaagcagagcagtgagtcggctgtgagcagcaccatc
aaccctgtcgccattcacaaacgcagcaaggtcaagaccgagcctgagggcctgcggccg
gcctcccctctggcactgacgcaggagcagctggctgacctcaaggaagacttggacagg
gatgactgcaagcaggaggctgaggtggtcatctatgagaccaactgccactgggaagac
tgcaccaaggagtacgacacccaggagcagctggtgcaccacatcaacaacgagcacatc
catggggagaagaaggagttcgtgtgccgctggcaggcctgcacgcgggagcagaagccc
ttcaaggcacagtacatgctggtggtgcacatgcggcggcacacgggcgagaagccccac
aagtgcacgttcgagggctgctcgaaggcctactcacgcctggagaacctgaagacgcac
ctgcggtcccacaccggggagaagccatatgtgtgtgagcacgagggctgcaacaaggcc
ttctctaatgcctcggaccgtgccaagcaccagaaccgcacccactccaatgagaaaccc
tacatctgcaagattccaggctgcacgaagcgatacacagaccccagctctctccggaag
catgtgaaaacggtccacggcccagacgcccatgtcaccaagaagcagcgcaacgacatg
cacctccgcacaccactgctcaaagagaacggggacagtgaggccggcaccgagcctggc
ggccgtgcttctgaggacagcgccgaggccagtagcaccagccacgctgtggaggactgc
ctgcacgtcagagccatcaagaccgagagctccgggctgtgtcagtccagccccggggcc
cagtcatcctgcagcagcgagccctctcccctgggcagtgcccccaacaatgacagtggt
gtggagatgccggggacggggcccgggagcctgggagacctgacggcgctggatgacaca
cctccaggggccgacacctcagccctggctgccccctccactggtggcctccagctgcgc
aaacacatgaccaccatgcaccgatttgagcagctcaagaaggagaagctcaagtcactc
aaggattcctgctcatgggccgggccgactccacacacgcggaacaccaagctgcctccc
ctcccgggaagtggaacgacttttggttgcccgacgatttggtgcagttatatcaaggcg
cacgccagtggcgctctggatgaaggtgccgggcaggtgtatcccacggaaagcactggt
ttctctgaaaaccccaaactgcccagcccggggctgcatggccagcggaggatgngtgct
gcggactccaatgtcagcccctctgcccctgtgctgggaggatgccagctgggctttggg
gcaccctccagcctgaacaaaaataacatgcctgtgcagtggaacgaggtgagctccggc
acagtggacgccctggccagccaggtgaagcctccacccgttcctcagggcaacctggcg
gtggtgcagcagaagccagcctttggccagtacccaggctacagtccacaaggcctacag
gcgagtcctgggggcctggacagcacacagccacaccttcagctccccagcggagcccct
tcccagggcatgcccagagtaaactacatgcagcagctgcgacagccagtggcaggcagc
cagtgtcctggcatgactaccgctatgagcccccatgcctgctatggccaggcccacccc
cagctgagccccagcaccatcagtggggccctcagccagtttgccccatcctgcagcagc
atgccagccaagccaggccatctgggacacccacagcagacagaagttgcacctgaccct
accatgatggccaaccgccacagggaactcggggtcctcaattcagccctggctggagtg
ccaccacctcacccagtccagagctacccacagcagagccatcacctggcagcccccatg
agccaggagggctaccaccaggtccccagccttctgcctgcccgccagcctggcttcatc
gagccccagccaggcccaatgggagtggctacagcaggctttggcctagtgcagccccgg
cctccacccgaccccagccccgctggccgccaccgtggggtacgtgctgcgcagcagcag
ctggcctatgccagggccacaggccatgccatggctgccatgccctccagtcaggagaca
gcagaggctgtgcccaagggagcgatgggcaccatggggtcggtgcatccccagccgcct
ctgccagactcggggcccccggaccacagcatgctctactactatggccagatccacatg
tatgaacaggatggaggcctggagaacctcgggggctgccaagtcacaaggtcccagcca
ccacagccacaggcctgcctggacaacatccagccccagcccttgccctcaccaggagtc
aaccaagtgtccagcactgtggactcccagctcctggaggccccccagattgactttgat
gccatcatggatgatggcgatcactcgagtttgttctcgggtgctctgagccccagcctc
ctccacaatctctcccagaactcctcccgcctcaccaccccccgaaactccctgaccctg
ccctccatccccgcaggcatcagcaacatggctgttggggacatgagctccatgctcacc
agcctcgcggaggagagcaagttcctgaacatgatgacctag

DBGET integrated database retrieval system