KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401096Help
Entry
100401096         CDS       T03264                                 

Gene name
LY86
Definition
(RefSeq) lymphocyte antigen 86
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
SSDB OrthologParalogGFIT
Motif
Pfam: E1_DerP2_DerF2
Motif
Other DBs
NCBI-GeneID: 100401096
NCBI-ProteinID: XP_002746294
Ensembl: ENSCJAG00000021363
LinkDB All DBs
Position
4
AA seq 162 aa AA seqDB search
MKGFTVALLLWTLISPSCRGGSGGGAWPTHMACSDSGLEVLYQSCDPLQDFGFSIEKCSK
ELKPKVNIRFGIILREDIKELFLDLALMAKGSSVLNFSYPICEEALPKFSFCGRRKGEQI
YYAGPVNNPGIEIPQGEYQVLLELYTEKRSTVACANATIICS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtttcacagtcgctctcctcctctggactctgatttctcccagctgccgtgga
ggcagcggagggggagcctggcccacacacatggcctgcagtgacagcggcttggaagtg
ctctaccagagttgcgatccattacaagattttggcttttctatcgaaaagtgttccaag
gaattaaaaccaaaagtcaacattagatttggaattatcctgagagaggacatcaaagag
ctatttcttgatctagctcttatggctaaaggctcatctgttttgaatttctcctatccc
atctgtgaggaggctctgcccaagttttccttctgtggaagaaggaaaggagagcagatt
tactatgctggccctgtcaataatcctggaattgaaattccccagggagaataccaggtt
ctgctagaactgtatactgaaaaacggtcgaccgtggcctgtgccaatgctaccatcatt
tgctcctga

DBGET integrated database retrieval system