KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401343Help
Entry
100401343         CDS       T03264                                 

Gene name
ADD1
Definition
(RefSeq) adducin 1
  KO
K18622  adducin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100401343 (ADD1)
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     100401343 (ADD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-GeneID: 100401343
NCBI-ProteinID: XP_002746083
Ensembl: ENSCJAG00000014227
LinkDB All DBs
Position
3
AA seq 774 aa AA seqDB search
MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDLRQDFNMMEQKKRVSM
ILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTTNVPNVYPAAPQGGMAALNMS
LGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLFGWSQLIYNHITTRVNSEQEHF
LIVPFGLLYSEVTASSLVKVNLQGDIVDRGSTNLGVNQAGFTLHSAIYAARPDVKCVVHI
HTPAGAAVSAMKCGLLPISPEALSLGEVAYHDYHGILVDEEEKVLIQKNLGPKSKVLILR
NHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDNLVLLNPEKYKAKSRSPGSPV
GEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPALREKSKKYSDVEVPASVTGYS
FASDGDSGTCSPLRHSFQKQQREKTRWLNSGRGDEASEEGQNGSSPKSKTKVWTNITHDH
VKPLLQSLSSGVCVPSCITNCLWTKEDGHRTSTSAVPNLFVPLNTNPKEVQEMRNKIREQ
NLQDIKTAGPQSQVLCGVVMDRSLVQGELVTASKAIIEKEYQPHVIVSTTGPNPFTTLTD
RELEEYRREVERKQKGSEENLDDTREQKEESPPDQPAVPHPPPSTPIKLEEDLPPEPTTG
DDSDAATFKPTLPDLSPDEPSEALGFPMLEKEEDAHRPPSPTEAPAEASPEPAPAPAPAP
APAPVAEEPAPSAADEGAAADPGSDGSPGKSPSKKKKKFRTPSFLKKSKKKSDS
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtgattctcgtgctgcggtggtgacctcaccacccccgaccacagcccctcac
aaggagaggtactttgaccgagtggatgagaacaacccagaatacttgagggaaaggaac
atggcaccagaccttcgccaggacttcaacatgatggagcaaaagaagagggtgtccatg
attctacaaagtcctgctttctgtgaagaattggaatcaatgatacaggagcaatttaag
aaggggaagaaccccacaggccttttggcattacagcagattgcagattttatgaccacg
aatgtaccaaatgtctacccagcggctcctcaaggagggatggctgccttaaacatgagt
ctcggtatggtgactcctgtgaatgatcttagaggatctgattcgattgcgtatgacaaa
ggagagaagttactgcggtgtaaattggcagcgttttatagactagcagatctcttcggg
tggtctcagcttatctacaatcatatcacaaccagagtgaactctgagcaggaacacttc
ctcattgtacctttcgggcttctttatagtgaagtgactgcatccagtttggttaaggtc
aatctacaaggagacatagtagatcgtggaagcactaatctgggagtcaatcaagctggc
ttcaccttacactctgcaatttacgctgcacgcccggacgtgaagtgcgttgtgcacatt
cacaccccagcaggggctgcggtctctgcaatgaaatgtggcctcttgccaatctccccg
gaggcgctttcccttggagaagtggcttatcatgactaccatggcattctggtggatgaa
gaggaaaaagttctgattcagaaaaatctggggcctaaaagcaaggttcttattctccgg
aaccacgggcttgtgtcagttggagagagcgttgaggaggccttctattacatccataac
cttgtggttgcctgtgagatccaggttcgaactctggccagtgcaggaggcccagacaac
ttagtcctgctgaatcctgagaagtacaaagccaaatcccgttccccaggctctccggta
ggggaaggcactggatcgcctcccaagtggcagattggtgagcaggaatttgaagccctc
atgcggatgcttgataatctgggctacagaactggctacccttaccgataccctgctctg
agagagaagtctaaaaaatacagcgatgtggaagttcctgctagtgtcacaggttactcc
tttgctagtgacggtgattcgggcacttgctcccctctcagacacagttttcagaagcag
cagcgggagaagacaaggtggctgaactctggccggggtgatgaagcttctgaggaaggg
cagaatggaagcagtcccaagtcgaagactaaggtgtggacgaacattacacacgatcac
gtgaaacccttgctgcagtctctctcgtccggtgtctgcgtgccaagctgtattaccaac
tgcttgtggactaaagaggatggacatagaacttccacctctgctgtccctaacctgttt
gttccattgaacactaacccaaaggaggtccaggagatgaggaacaagatccgagagcag
aacttacaggacattaagacggctggccctcagtcccaggttttgtgtggtgtagtgatg
gacaggagcctcgtccagggagagctggtgacagcctccaaggccatcattgagaaggag
taccagccccacgtcattgtgagcaccacaggccccaaccctttcaccacgctcacagac
cgcgagctggaggagtaccgcagagaggtggagcggaagcagaagggctccgaagagaat
ctggatgatactagagaacagaaagaagagagtcctcctgaccagcctgcggtcccccac
ccgcctcccagcactcccatcaagctggaggaagaccttccgccggagccgacgactgga
gatgacagtgatgccgccacctttaagccgactctccccgatctgtcccctgacgagcct
tcagaagcacttggcttcccaatgttagagaaggaggaggatgcccatagacccccaagc
cccactgaggcccctgctgaggccagccccgagccagccccagccccagccccagcccca
gccccagccccagtggcggaagagcctgccccctcagctgccgacgagggggctgctgcg
gaccctggcagtgatgggtctccaggcaagtccccatccaaaaagaagaagaagttccgt
accccgtcctttctgaagaagagcaagaagaagagtgactcctga

DBGET integrated database retrieval system