KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401369Help
Entry
100401369         CDS       T03264                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100401369 (SUV39H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100401369 (SUV39H1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100401369 (SUV39H1)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100401369 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100401369 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pre-SET SET Chromo
Motif
Other DBs
NCBI-GeneID: 100401369
NCBI-ProteinID: XP_017823757
LinkDB All DBs
Position
X
AA seq 458 aa AA seqDB search
MAENLKGCRVCCKSSWNQLQDLCRLAKLSCPALGVSKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRXVQKG
IRYDLCIFRTDDGRAWGVRTLSFIFYPGNIRISRDSVTPVLTLPALHTFSIHYFLAALQH
PQTPVPPENGDRAWSLYFPNQTIITSEEAERRGQIYDRQGATYLFDLDYVEDVYTVDAAY
YGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATKTIRAGEELTFDYNMQVDPVDM
ESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaaggctgtcgtgtgtgttgcaagtcttcttggaatcagctgcag
gacctgtgccgtctggccaagctctcctgccctgcccttggtgtctctaagaggaacctc
tatgactttgaagtcgagtacctgtgcgattacaagaagatccgagaacaggaatattac
ctggtgaaatggcgtggatatccagactcagagagcacctgggagccacggcagaatcta
aagtgtgtgcgcatcctcaagcagttccacaaggacttagagagggagctgcttcggcgg
caccaccggtcaaagaccccccggcacctggacccaagcttggccaactacctagtgcag
aaggccaagcagaggagggcgctccgtcgctgggagcaggagctcaatgccaagcgcagc
catctgggacgtatcaccgtagagaatgaggtggacctggacggccctccgcgggccttt
gtgtacatcaatgagtaccgtgttggtgagggcatcaccctcaaccaggtggctgtgggc
tgcgagtgccaggactgtctgtgggcacccaccggaggctgctgcccgggggcgtcactg
cacaagtttgcctacaatgaccagggccaggtgcggcttcgagccgggctgcccatctac
gagtgcaactcccgctgccgctgtggctatgactgcccaaatcgtngtgttcagaagggc
attcgatatgacctctgcatcttccgcacagatgacgggcgcgcctggggcgtccgcact
ctatctttcatcttctaccctggaaacatcaggatttccagggattctgtcacccctgtc
ctcacccttcctgctctccacacattctcgatacactatttcctggccgccctccagcac
cctcagacccctgtgccccctgagaatggggaccgggcctggtccctgtatttccctaat
cagactattattacctcagaggaggcagagcgacggggccagatctacgaccgccagggc
gccacctacctctttgacctggactacgtggaggacgtgtacaccgtggatgccgcctac
tatggcaacatctcccactttgtgaaccacagttgtgaccccaacttgcaggtgtacaac
gtcttcatagacaaccttgatgagcggctgccccgcatcgctttctttgccacaaaaacc
atccgggcaggcgaggagctcacctttgattacaacatgcaagtggaccccgtggacatg
gaaagcacccgcatggactccaactttggcctggctgggctccctggctcccctaagaag
cgggtccgtattgaatgcaagtgtgggactgagtcctgccgcaaatacctcttctag

DBGET integrated database retrieval system