KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401526
Entry
100401526         CDS       T03264                                 

Gene name
GLI1
Definition
(RefSeq) GLI family zinc finger 1
  KO
K16797  zinc finger protein GLI1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04340  Hedgehog signaling pathway
cjc05200  Pathways in cancer
cjc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100401526 (GLI1)
   04024 cAMP signaling pathway
    100401526 (GLI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100401526 (GLI1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100401526 (GLI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100401526 (GLI1)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    100401526 (GLI1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 IL17
Other DBs
NCBI-GeneID: 100401526
NCBI-ProteinID: XP_002752694
Ensembl: ENSCJAG00000007324
UniProt: F7AEX2
LinkDB
Position
9
AA seq 1106 aa
MFNSMTPPPVSSYGEPCCLRPLPSQGAPSVGTEGLSGLPFCHQANLMSGPHSYGPARETN
SCTEGPLFSSPRSTVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGS
YGHLSIGTMSPSLGFPPQMNHQKGPSPSFGVQPCGPHESSRGGMIPHPQSRGSLPTCQLK
SELDMLVGKCREEPLEGDMSSPNSTGIQDPLLGMLDGREDLEREEKREPESVYETDCRWD
GCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKP
HKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEK
PYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPSLSTVEPKREREG
GPIREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSS
LDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTPVSRRLGPPVSLD
RRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGG
TPPTAASSLDRIGGLPVPPWRSRAEYPGYNPNAGVTRRASDPARAADRPVPARVQRFKSL
GSVHTTPTVGGGGQNFDPHLPTSVYSPQPPSITENAAMDTRGLQEEPEVGTSMMGSGLNP
YMDFPPADTLGYGGPEGAAAEPYGARGPGSLPLGPGPPISYGPNPCPQQASYPDPTQETW
GEFPSHSGLYPGPKALGGAYSQCPRLEHYGQVQVKPEQGCPVGSDTTGLAPCLSAHPDEG
PPHPQPLFSHYPQPTPPQYLQSGPYTQPPPDYLPSEPRPCLDFDSPTHSTGQLKAQLVCN
YVQSQQELLWEDGGREDAPAQEPSYESPKFLGGSQVSPSPAKAPVTTYGPGFGLNLPNHK
SGSYPTPSPCHENFVVGANRASHSAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLG
GGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEAQGLSPPPSHDQGGSSGHTPHHAGP
PNMAVGNMSVLLRSLPGETQFLNSSA
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgttcaactcgatgaccccaccaccagtcagtagctatggcgagccctgctgtctccgg
cccctccccagtcagggggcccccagtgtggggacagaaggactgtctggcctgcccttc
tgccaccaagctaacctcatgtctggcccccacagttatgggccagccagagagaccaac
agctgcaccgagggcccactcttttcttctccccggagtacagtcaagttgaccaagaag
cgggcattgtccatttcaccgctgtcggacgctagcctggacctgcagacggttatccgc
acctcacccagctcccttgtagctttcatcaactcgcgatgcacatccccaggaggctcc
tatggccatctctccattggcaccatgagcccatctctgggattcccaccccagatgaat
caccaaaaagggccctcgccttctttcggggtccagccctgtggtccccatgaatcctcc
cgaggtgggatgatcccacatcctcagtctcggggatccctcccaacttgccagctgaag
tctgagctggacatgctggttggcaaatgccgggaggagcccttggaaggtgatatgtcc
agccccaactccacaggcatacaggatcccctgttggggatgctggatgggcgggaggac
cttgagagagaggagaagcgtgaacctgaatctgtgtatgagactgactgtcgttgggat
ggctgcagccaggaatttgactcccaagagcagctggtgcaccacatcaacagcgaacac
atccatggggagcggaaggagttcgtgtgccactgggggggctgctccagggagctgagg
cccttcaaagcccagtacatgctggtggtgcacatgcgcagacacactggcgagaagcca
cacaagtgcacgtttgaagggtgccggaagtcatactcacgcctcgaaaacctgaagaca
cacctgcggtcacacacgggtgagaagccatacatgtgtgagcatgaaggctgcagcaaa
gccttcagcaatgccagtgaccgagccaagcaccagaatcggacccactccaatgagaag
ccgtacgtgtgtaagctccctggctgcaccaaacgctatacagatcccagctcgctgcgg
aaacatgtcaagacagtgcatggtcctgatgcccatgtgaccaagcggcaccgtggggac
ggccctctacctcgggcaccctccctttccacagtggagcccaagagggagcgggaagga
ggccccatcagggaggagagcagactgactgtgccagagggtgccatgaagccacagcca
agccctggggcccagtcatcctgcagcagtgaccactccccggcaggcagtgcagccaat
acagacagcggtgtggaaatgaccggcaatgcagggggcagcactgaagacctctccagc
ctggatgaggggccttgcattgctggcactggtctgtccactctccgccgccttgagaac
ctcaggctggaccagctgcatcaactccggccaatagggacccggggtctcaaactgccc
agcttgtcccacactggtacccctgtgtcccgccgcctgggccccccagtctctcttgac
cgccgcagtagcagctccagcagcatcagctctgcctatactgtcagccgtcgctcctcc
ctggcgtcccctttcccccctggctccccaccagagaatggagcatcctccctgcctggc
cttatgcctgcccagcactacctgctccgggcaagatatgcttcagccagagggggtggt
accccgcccactgcagcatccagcctggatcggatagggggtcttcctgtgcctccttgg
agaagccgagctgagtatccaggatacaatcccaatgcaggggtcacccggagggccagt
gacccagcccgggctgctgaccgtcctgttccagctagagtccagaggttcaagagcctg
ggctctgtccatacaacacccactgtgggagggggaggacagaacttcgatcctcacctc
cccacctctgtctactcaccacagccccccagcatcactgagaatgcggccatggatact
agagggctacaggaggagccagaagttgggacctccatgatgggaagtggtctgaacccc
tatatggacttcccacctgctgatactctgggatatgggggacctgaaggggcagcagct
gagccttatggagcgaggggtccaggctccctgcctcttgggcctggtccacccatcagc
tatggccccaacccctgtccgcagcaggcctcatatcctgaccccacccaagaaacatgg
ggtgagttcccttcccactctgggctgtacccaggccccaaggctctaggtggagcctat
agccagtgtcctcgacttgaacattatggacaagtgcaagtcaagccggaacagggatgc
ccagtggggtctgacaccacaggactggcaccctgcctcagtgcccaccccgatgagggg
cccccacacccacagcctctcttttcccactatccccagcccactcctccccaatatctc
cagtcaggcccctatacccagccaccccctgattatcttccttcagaacccaggccttgc
ctggactttgattcccccacccattctacagggcagctcaaggctcagcttgtgtgtaat
tatgttcagtctcaacaggaactgctgtgggaggatgggggcagggaagatgccccagcc
caggaaccttcctacgagagtcccaagtttctggggggttcccaggttagcccaagccct
gctaaagctccagtgaccacatatggacctggctttggactcaacttacccaatcacaag
tcaggctcttatcccaccccttcaccatgccatgaaaattttgtagtgggggcaaacagg
gcttcccatagtgcagcagcaccacctcgacttctgcctccattgcccacttgctatggg
cccctcaaagtgggaggcacaaaccccagctgtggccatcctgaggtgggcaggctggga
gggggtcctgccttgtaccctcctcccgaaggacaggtatgtaaccccctggactctctt
gatcttgacaacactcagctggactttgtggctattctggatgaggcccaggggctgagt
cctcctccttcccatgatcaggggggcagctctggacataccccacatcatgctgggccc
cccaacatggctgtaggcaacatgagtgtcttactgagatccctcccgggggagacacaa
ttcctcaactctagtgcctaa

DBGET integrated database retrieval system