KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401731Help
Entry
100401731         CDS       T03264                                 

Gene name
MYPOP
Definition
(RefSeq) Myb related transcription factor, partner of profilin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_DNA-bind_5 MADF_DNA_bdg Myb_DNA-binding Myb_DNA-bind_6 Myb_DNA-bind_4
Motif
Other DBs
NCBI-GeneID: 100401731
NCBI-ProteinID: XP_002807899
LinkDB All DBs
Position
22
AA seq 399 aa AA seqDB search
MASAAAAGETEETTRLRKPRFSFEENQILIREVRAHYPQLYGAQSRRVSVAERRRVWDGI
AAKINGITSWKRTGQEVQKRWNDFKRRTKEKLARVPHSTQGAGPAAEDAFSAEEETIFAI
LGPGVAGPGAGAGAEEPPAAPSSQPPPPSACPQRYVLSEDRREDRRADTSAHSKGGSSSP
EPWARPSCNPQEGGCPRPKERESPPPSALQPVQLPRLALSPPPPAPPLPPPLPLAQVAPS
PPSPPPPPRPPPMLLAPDPSLDFLRAQQETANAIRELAGTLRQGLAKLSEALSALLPLLP
GTPVDSLPPPLPPPPPPAPRPVLPPPAPKVEITPEPVSVVAAVVDGAVVAARGRIYIAPR
SEEGVPRPPSAPLPPHDSPPHKRRKGFPTRKRRGRWKSP
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggcggcggcggctggcgaaacagaggaaaccacccggctgcgcaagccgcgc
ttctcgttcgaagagaaccagatcctgatccgcgaggtgcgcgcccactacccgcagctc
tacggcgcgcagagccgtcgggtgagcgtggccgagcggcgtcgtgtgtgggacggcatc
gccgccaagatcaacggtatcaccagctggaagcgcacgggccaggaggtgcagaagcgc
tggaacgacttcaagcgccgcaccaaggagaagctcgcccgcgtgccgcactccacgcag
ggtgccgggcccgccgccgaggacgccttctccgcggaagaggaaaccatttttgccatc
ctggggccaggtgtggcggggccaggagcaggtgctggggcggaggagccccctgcagcc
ccctcttcacagccgccgcccccaagcgcctgcccccaacgctatgtgttgtcagaagat
cgcagggaggaccgacgtgcagatacatcagcccacagcaaggggggctccagcagcccc
gagccctgggcccggccctcctgcaatcctcaggaagggggctgccctcggcccaaggag
cgtgagtccccacccccttcggccctgcagccagtccagctgcctcgcctggccttgtct
ccaccacccccagcccctccactgccacctccactgccactggcccaagtggcaccctcg
cccccaagccccccaccccctcctcggcctccacccatgctcttggccccagacccctcc
ctggacttcctgcgagcccagcaggagactgccaacgccatccgggagctggctggcacc
cttcgacagggactggccaaactgagcgaggccctcagcgccctgctgccccttctgcca
ggaaccccagtcgactccctccccccacctctgccgccacccccacccccagctcccagg
cctgtcctgccccctccagcccccaaagtagagatcaccccagagcccgtgtccgtggta
gctgctgtggtggacggggcagtggtggcagccaggggtagaatatacattgccccaagg
agcgaggagggggtgccccggccaccctcagccccactccctccacacgactccccccca
cacaagcggagaaaaggtttccctacacggaaaaggcgcggtcgatggaaatctccgtga

DBGET integrated database retrieval system