KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401754
Entry
100401754         CDS       T03264                                 

Gene name
RAPGEF4
Definition
(RefSeq) Rap guanine nucleotide exchange factor 4
  KO
K04351  Rap guanine nucleotide exchange factor 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04024  cAMP signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04670  Leukocyte transendothelial migration
cjc04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100401754 (RAPGEF4)
   04072 Phospholipase D signaling pathway
    100401754 (RAPGEF4)
   04024 cAMP signaling pathway
    100401754 (RAPGEF4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100401754 (RAPGEF4)
  09152 Endocrine system
   04911 Insulin secretion
    100401754 (RAPGEF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100401754 (RAPGEF4)
Membrane trafficking [BR:cjc04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    100401754 (RAPGEF4)
SSDB
Motif
Pfam: RasGEF DEP cNMP_binding RasGEF_N
Other DBs
NCBI-GeneID: 100401754
NCBI-ProteinID: XP_002749385
Ensembl: ENSCJAG00000007525
LinkDB
Position
6
AA seq 858 aa
MAGLLAPPYGVMETGSNNDRIPDKENTPLIEPHVPLRPANTITKVPSEKILKAGKILRNA
ILSRAPHMIRDRKYHLKTYRQCCVGTELVDWMMQQTPCVHSRTQAVGMWQVLLEDGVLNH
VDQEHHFQDKYLFYRFLDDEHEDAPLPTEEEKKECDEELQDTMLLLSQMGPDAHMRMILR
KPPGQRTVDDLEIIYEELLHIKALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTS
WYIILKGSVNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDF
NRILRDVEANTVRLKEHDQDVLVLEKVPAGNRASNQGNSQPQQKYTVMSGTPEKILEHFL
ETIRLEASLNEATDSVLNDFIMMHCVFMPNTQLCPALVAHYHAQASQGTEQEKMDYALNN
KRRVIRLVLQWAAMYGDLLQEDDVSMAFLEEFYVSVSDDARMIAALKEQLPELEKIVKQI
SEDAKAPQKKHKVLLQQFNTGDERAQKRQPIRGSDEVLFKVYCMDHTYTTIRVPVAASVK
EVISAVADKLGSGEGLIIVKMSSGGEKVVLKPNDVSVFTTLTINGRLFACPREQFDSLTP
LPEQEGPTVGTVGTFELMSSKDLAYQMTIYDWELFNCVHELELIYHTFGRHNFKKTTANL
DLFLRRFNEIQFWVVTEICLCSQLSKRVQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNV
AVSRLALTWEKLPSKFKKFYAEFESLMDPSRNHRAYRLTIAKLEPPLIPFMPLLIKDMTF
THEGNKTFIDNLVNFEKMRMIANTARTVRYYRSQPFNPDAAQANKNHQDVRSYVRQLNVI
DNQRTLSQMSHRLEPRRP
NT seq 2577 nt   +upstreamnt  +downstreamnt
atggcaggacttctggctcctccttatggtgttatggaaacgggctctaacaatgacagg
attcctgacaaggagaacacacctctcattgaacctcacgttcctcttcgtcctgctaac
accattaccaaggtcccttcagagaagatcctcaaggctggaaaaattttacgaaatgcc
attctctctcgagcacctcacatgataagggatagaaaataccacctaaagacatacaga
caatgctgtgtgggaacagagctggtggactggatgatgcagcagacaccatgtgttcac
tctcggactcaagctgttggcatgtggcaagttctgttagaagacggtgttctcaaccac
gtggaccaagagcaccatttccaagacaaatatttattctatcgatttctggatgacgag
catgaggatgcccctttgcctactgaggaggagaagaaggagtgtgatgaagagctccag
gacaccatgctgctgctgtcccagatgggccccgatgcccacatgaggatgatcctccgc
aaaccacctggccagaggactgtggacgacctagagataatctatgaagagctccttcat
attaaagccttatcccatctttctaccacagtgaaaagagagttagcaggtgttctcatt
tttgagtctcatgccaaaggaggaaccgtgttgtttaaccagggagaagaaggtacctcc
tggtacattattctaaaaggatcagtgaatgtagtcatttacggcaagggtgtggtctgc
accctgcatgaaggagacgacttcggcaagttagcactagtgaatgatgccccgagagct
gcctctatcgtcttgcgagaagataattgccatttcttaagagtagacaaggaggatttc
aaccggatcctgagggacgtggaggcgaatacagttagacttaaagaacatgaccaagat
gtcttggtgctggagaaggtcccagcagggaacagagcttctaatcaaggaaactcacag
cctcagcaaaagtatactgtgatgtcaggaacacctgaaaaaattttagagcattttcta
gaaacaatacgccttgaggcaagcttaaatgaagcaacagattctgttttaaatgacttc
attatgatgcactgtgtttttatgccaaatacccagctttgcccagccctggtggcccat
taccacgcacaggcttcacaaggtacagaacaggagaaaatggattatgccctcaacaat
aagaggcgagtcatccgcctggttctacagtgggctgccatgtatggagacctcctacaa
gaggatgatgtgtctatggcgttcctggaggagttttatgtatctgtatcagatgatgcc
cggatgattgctgccctcaaggagcaactgccagagttggagaagattgtcaagcaaatc
tcagaagatgcaaaggcaccacaaaagaagcacaaggttcttttgcaacagttcaatacg
ggtgatgagagagcccagaagcgccagcctatccgcggctctgatgaagttctgtttaaa
gtctattgcatggaccacacctacacaaccatccgggtgccggtggccgcctcggtgaag
gaagtcatcagcgcagttgccgacaagctgggctccggggaaggcctgatcatagtcaag
atgagttctgggggagaaaaggtggtgctcaaacctaatgatgtttcagtatttacgaca
ctcaccattaatggacgcctgtttgcttgcccacgagagcaattcgattcactgactccc
ttaccagaacaggaaggcccaactgttggaacagtgggaacttttgaactgatgagctcc
aaagatttagcataccagatgacaatttatgattgggaactcttcaactgcgtgcatgag
ctggagctaatctatcacacatttggaaggcataattttaaaaagaccacagcaaacttg
gatttgttcctgaggagatttaatgaaattcagttttgggtcgtcactgagatctgcctt
tgttctcagctcagcaagcgtgttcagctattaaaaaaatttattaagatagcagcccac
tgtaaggagtataaaaatctgaattccttttttgccatcgtcatgggactaagtaacgtt
gctgtgagccgcttggctctaacgtgggagaaactgccaagcaagttcaagaagttctat
gcggagtttgaaagtttaatggacccttcaaggaaccacagggcctacaggctgacgata
gctaagctggagcctcctctcatccccttcatgcctttgctcattaaagatatgacattt
actcatgaggggaacaagacgttcattgacaatctagtaaactttgaaaaaatgcgcatg
attgcaaatacggccagaacagtgagatactacaggagccaacccttcaatcctgatgca
gctcaagctaataagaaccatcaggatgtccggagttatgtgcgccaattaaatgtgatt
gacaaccagagaactttatcccagatgtcacacagattagagcctcggcgaccatag

DBGET integrated database retrieval system