KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401868Help
Entry
100401868         CDS       T03264                                 

Gene name
HOXB4, HOXB3
Definition
(RefSeq) homeobox B4
  KO
K09304  homeobox protein HoxA/B/C/D4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100401868 (HOXB4)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Antp
    100401868 (HOXB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain DUF2209 HTH_23
Motif
Other DBs
NCBI-GeneID: 100401868
NCBI-ProteinID: XP_017828185
LinkDB All DBs
Position
5
AA seq 245 aa AA seqDB search
MAMSSFLINSNYVDPKFPPCEEYSQNDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRAAC
TVQRYAACLDPGPPPPPPPPPPPPPPPGLSPRAPVPPPAGALLTEPSQRCEAVSSSPPPP
PCAQNPLNPSPSHSACKEPVVYPWMRKVHVSTVNPNYAGGEPKRSRTAYTRQQVLELEKE
FHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGAASSAGGP
PGRPN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggctatgagttcttttctgatcaactcaaactatgtcgaccccaagttccctccatgc
gaggaatattcacagaacgattacctacccagcgaccactcgcccgggtactacgccggc
ggccagaggcgagagagcagcttccagccggaggcgggcttcgggaggcgcgcggcgtgc
acggtgcagcgctacgcggcctgcctggaccctgggcccccgccgcctccgccaccaccc
ccgccgcccccgccaccgcccgggctgtcccctcgggctcccgtgccgccacccgccggc
gccctcctcacggagcccagccagcgctgcgaggcggtcagcagcagccccccgccgcct
ccctgcgcccagaatcccctgaaccccagcccgtcccactccgcgtgcaaagagcccgtc
gtctatccctggatgcgcaaagttcacgtgagcacggtaaaccccaattacgcaggcggg
gagcccaagcgctctcggaccgcctatactcgccagcaggtcttggagctggagaaggaa
tttcactacaaccgctacctgacgcggcgccggagggtggagatcgcccacgcgctctgc
ctctctgagcgccagatcaagatctggttccagaaccggcgcatgaagtggaaaaaagac
cacaagttgcccaacaccaagatccgctcgggtggcgcggcaagctcagccggagggccc
cctggccggcccaattga

DBGET integrated database retrieval system