KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401995Help
Entry
100401995         CDS       T03264                                 

Gene name
WHAMM
Definition
(RefSeq) WAS protein homolog associated with actin, golgi membranes and microtubules
  KO
K20479  WASP homolog-associated protein with actin, membranes and microtubules
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04530  Tight junction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100401995 (WHAMM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100401995 (WHAMM)
Membrane trafficking [BR:cjc04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    100401995 (WHAMM)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    100401995 (WHAMM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JMY WHAMM-JMY_N WH2 PhaP_Bmeg
Motif
Other DBs
NCBI-GeneID: 100401995
NCBI-ProteinID: XP_008996732
Ensembl: ENSCJAG00000015916
LinkDB All DBs
Position
6
AA seq 811 aa AA seqDB search
MEDEQPDSLEGWVPVREGLFAEPERHRLRFLVAWNGAEGKFAVTCHDRTAQRRWRREGAQ
PEPEPEAAMSPPSWAGLLSAAGFRGAHRQLAALWPPLERCFPRLPPELDVGGGGGAWGLG
LGLWALLWPARAGPGEAALRELCGRLERYLGEAADGCGGATVRDALFPAEGGAADCESLR
EFRERALRARWTEADARLRQVLQGHTKANTMVALMKVYQEEDEAYQELVTVATTFFQYLL
QPLRAMREVATLCKLDILKSLDEDDLGPRRVVALEKEAEEWTRRAEEAVISIQDITVNYF
KETVKALAGMQKQMEQDGKRFGQAAWATATPRLEKLKLMLARETLQLMRAKKLCLNHKRA
EIQGKMEDLPEQEKNINVVDELEIKFYEIQLELYDVKFEILRNEEILLTTQLDSLKRLIK
EKQDEVVYYDPCESPEELKVIDCVVGLQDNKNLEVKELRRQCQQLESKRGRICAKRASLR
SKKDQCKENHQLRLQQAEESIKYSRQHHSIQMKRDKIKEEEQKNKEWINQERQKTLQRLR
AFKDKHLGQSVRKTSGAEPVAPNLPGGLSQQTCLPASQVVSAIHPSSRKTRGVPLLEASN
VKTPKCQDCHGNTSVQVFVPVGDQTHSKSSEELSLPPPPPPLRRPPPPPPPPPPPPPAPA
PAPAPLPALSSCSEAATHQNLGFRAPMKDDQPLPLVCESPAERPRDSLGHFPCPGSMDEV
LASLRHGKAPLQKVEVPAVRPPHASVNEHILAAIRQGVKLKKVHPDLGPSPSSRHTSDLE
RSIKAALQRIKRVSADSEEDSDEQDAGQWDR
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgagcagcctgacagcctggagggctgggtgccggtccgagagggcctcttc
gccgagcccgagcggcaccggttgcgcttcctggtggcctggaacggcgcggagggcaag
ttcgctgtgacttgtcacgaccgcaccgcgcagcggcggtggcgacgcgagggggcccag
cccgagcccgagcccgaggccgccatgtcccccccaagctgggccggcctactttcggcc
gcggggttccgcggcgcgcaccggcaactggcggcgctatggccgcctctagagcgctgc
ttcccgcggctgccaccggagctggacgtaggtggcggcggcggggcctggggcctgggt
cttgggttgtgggcgctgctgtggccggcgcgcgcggggcccggagaggcggcgctgcgg
gagttgtgtggacggctggagcgctacctgggcgaggcggcagacggctgcggtggcgcc
accgtgcgcgacgcgctcttcccggctgagggcggcgcggcagactgcgagagcctgcgc
gagttccgggaacgggccctgcgcgcgcggtggaccgaagcggacgcgcggctgcgccag
gttcttcagggacacacaaaagccaacaccatggtggctttaatgaaagtttaccaagag
gaagatgaagcgtaccaggaattagttactgtggcaaccacgttcttccaatatttattg
cagccattaagggctatgagagaagttgcaactttatgtaagcttgatattttgaagtcc
ttggatgaggatgacctaggtcctagaagggtagttgccctggagaaagaagccgaagaa
tggaccagacgggctgaagaagctgtcatctctattcaagatatcacagtgaattatttc
aaggagacagtaaaagcattagcaggaatgcagaaacaaatggaacaggatgggaagaga
tttggccaggctgcctgggccacagcaactcccaggttggaaaaacttaagctaatgcta
gctcgagagactttgcaactcatgagagcgaaaaagctgtgtttaaatcacaaaagagct
gaaattcagggaaagatggaagatcttccagaacaagaaaaaaatatcaatgttgtagat
gaattagaaataaaattttatgaaattcagttagaactatatgatgttaaatttgagata
ttaagaaatgaagaaatactgcttactacacagttggactctcttaaaagacttataaaa
gaaaaacaggatgaagttgtctattatgatccgtgtgaaagtccagaggaacttaaagtc
attgactgtgtggtggggctgcaggacaataagaatttggaagtgaaagaactcagaagg
cagtgccagcagctggagtctaaacggggcaggatctgtgccaaaagagcctctctccgg
agcaaaaaggatcagtgcaaagaaaatcatcagctcagattgcaacaggctgaagaaagc
ataaaatactctcgtcagcatcatagtattcagatgaaaagagacaagataaaagaagag
gaacaaaagaacaaagaatggatcaaccaagaacgccaaaaaacactccaacgattgaga
gcatttaaagataagcacctaggtcaatctgtccgaaagacctctggcgcagaacctgtg
gctccaaacctgccaggtggcctttcccagcagacgtgcttgccagcttcccaggtggtg
tcagcaattcatccatcctctaggaaaactagaggtgttcccctattggaagctagtaac
gtgaaaacccccaagtgtcaagactgtcatggaaatacctctgtccaggtttttgttcca
gttggtgatcaaacacattccaaatccagtgaggaattgtcactgccacctcctccacca
ccactccgccgcccaccaccaccaccaccaccaccaccaccaccaccaccagcaccagca
ccagcaccagctcctctgcctgctctgtcctcatgctctgaagctgcaactcatcagaac
ttaggcttcagggctccaatgaaagatgaccagccacttcccctagtgtgtgaatcacct
gctgagaggccacgtgactccttgggacattttccatgtccaggatctatggacgaagtg
ttggcttccttaaggcatggcaaagcccctctccagaaggtagaagtgccagcagtgcgc
cctccccacgcctcagtcaatgagcacattctggctgccataaggcaaggggtcaaactg
aagaaagttcacccggaccttggcccaagccccagcagcagacacaccagtgaccttgag
aggagtatcaaggctgcactccagagaatcaagagggtgtctgctgactcagaggaagac
agtgatgagcaggacgccggccagtgggaccgttaa

DBGET integrated database retrieval system