KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402023Help
Entry
100402023         CDS       T03264                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc05034  Alcoholism
cjc05165  Human papillomavirus infection
cjc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    100402023 (HDAC7)
  09164 Substance dependence
   05034 Alcoholism
    100402023 (HDAC7)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    100402023 (HDAC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100402023 (HDAC7)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100402023 (HDAC7)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100402023 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100402023
NCBI-ProteinID: XP_017831271
Ensembl: ENSCJAG00000014979
LinkDB All DBs
Position
9
AA seq 987 aa AA seqDB search
MHSPSADGTQVSPGAHCRSPTGTGCPRPCADTPGPQSQPMDLRVGQRPPVEPPPEPTLLA
LQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVGPQEQELRQLLHKDKSKRSAVA
SSVVKQKLAEVILKKQQAALERTVHPSSPSIAYRTLEPLETERATRSMLSTFLPPVSSLP
SDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPTETLGDSSPSS
SSTPASGCSSPNDSEHGPNPILGSEALLGQRLRLQETSLAPFALPTVSLLPAITLGLPAP
ARADSDRRTHPTLGPRGPILGSPHTPLFLPHGLEPEAGGTLPSRLQPILLLDPSGSHAPL
LTVPGLGPLPFHFAQSLMTTERLSGSGLHWPLSRTRSEPLPPSATAPPPPGPMPHLEQLK
THMQVIKRSAKPSEKPRLRQIPSAEDLETDGGTPGQGVDDGLEHRELSHGQPEARGPASL
QQHPQVLLWEQQRLAGRLPRGSTGDTVLLPLAQGVHRPLSRAQSSPAAPASLSTSEPPSQ
ARVLSSSETPARTLPFTTGLVYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQERGLRS
QCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGVG
VDTDTIWNELHSSNAARWATGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFF
NSVAIACRQLQQQNKASKILIVDWDVHHGNGTQQTFYQDSSVLYISLHRHDNGNFFPGSG
AVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRIVVMPIAREFSPDLVLVSAGFDA
AEGHPAPLGGYHVSAKCFGYMTQQLMSLAGGAVVLALEGGHDLTAICDASEACVAALLGN
KVDPLSEEGWKQKPNLNAICSLEAVIRVHSKYWGCMQRLASCPDSWVPRPPGADKEEVEA
VTALASLSVGILAEDRPSEQLVEEKNL
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgcacagccccagcgccgatgggacccaggtgagcccgggtgcccactgtcgcagcccc
actggcacaggctgccccaggccctgtgcagacacaccaggccctcagtcccagcccatg
gacctgcgggtgggccagcggcccccagtggagcccccaccagagcccacattgctggcg
ctgcagcgtccccagcgcctgcaccaccacctcttcctagcaggcctgcagcagcagcgc
tcggtggagcccatgaggctctccatggacacgcccatgcccgagttgcaggtgggaccc
caggaacaagagctgcggcagcttctccacaaggacaagagcaagcgaagtgctgtagcc
agcagcgtggtcaagcagaagctggcagaggtgattctgaaaaagcaacaggcagctctc
gagagaacagtccatcccagcagccccagcatcgcctacagaaccctggagcccctggag
acagaaagagccacccgctccatgctcagcacctttttgcctcctgtttccagcctgccc
agtgaccccccagagcacttccccctgcgcaagacagtctctgagcccaacctgaagctg
cgctataagcccaagaaatccctggagcggaggaagaatccactgcttcggaaggagagt
gctccccccagcctccggcgacgacctacagagaccctcggagactcctccccaagtagt
agcagcacgcccgcgtcagggtgcagctcccccaatgacagcgagcacggccccaacccc
atcctgggctcggaggcgctcttgggccagcggctgcggctgcaggagacttctctggcc
ccgttcgccttgccgacagtgtccttgctgcccgctatcacgctggggctgcccgcccct
gccagggctgatagtgaccgcaggacccatccgactctgggccctcgggggccgatcctg
gggagccctcacactcccctcttcctgccccatggcctggagcccgaggctgggggtacc
ttgccctctcgcctacagcctattctccttctggacccctcaggctctcatgccccgctg
ctgactgtgcctgggcttgggcccctgcccttccactttgcccagtccttaatgaccacc
gagaggctctccgggtcaggcctccactggccactgagccggactcgctcagagcccctg
ccccccagtgccaccgctcccccaccgccgggccccatgccccacctggagcagctcaaa
actcacatgcaggtgatcaagaggtcagccaagccgagtgagaagccccggctgcggcag
ataccctcggctgaagacctggagacagatggcgggacacccggccagggggtggatgat
ggcctggagcacagggagctgagccatggacagcccgaggccagaggccctgcatctctt
cagcagcacccccaggtattgctctgggaacagcagcgactggctgggcggctcccccgg
ggcagcaccggggatactgtgctgcttcccctggcccagggagtgcaccggcccctgtcc
cgggctcagtcttccccagccgcacctgcctcactgtcaacctcggagccccccagccag
gcccgagtcctctccagctcagagacccctgccaggaccctgcctttcaccacagggctg
gtttatgactcggtcatgctgaagcaccagtgctcctgcggagacaacagcaggcacccg
gagcacgccggccgcattcagagcatctggtcccggctgcaggagcgggggctccggagc
cagtgtgagtgtctccgaggccggaaggcctccctggaagagctgcagtcggtccactct
gagcggcacgtgctcctctatggcaccaacccgctcagccgcctgaaactggacaacggg
aagctggcagggctcctggcacagaggatgtttgtgatgctgccctgtggtggggttggg
gtggacactgacaccatctggaatgagctgcattcctccaatgcagcccgctgggccact
ggcagtgtcaccgacctcgccttcaaagtggcttcccgtgagctgaagaatggtttcgct
gtggttcggcccccaggacaccatgcagatcattcaacagccatgggcttctgcttcttc
aactcagtggccatcgcctgccggcagctgcagcagcagaacaaggccagcaagatcctc
attgtagactgggacgtgcaccacggcaacggcacccagcagaccttctaccaagactcc
agtgtgctctacatctccctgcatcgccatgacaacggcaacttcttcccggggagtggg
gcagtggatgaggtaggggctggcagtggtgagggcttcaatgtcaatgtggcctgggct
ggaggcctggacccccccatgggggatccggagtacctggctgctttcaggatagtcgtg
atgcccatcgcccgagagttctctccagacctggtcctggtgtctgctgggtttgatgct
gctgagggccacccggccccgctgggtggctatcatgtttctgccaaatgttttgggtac
atgacacagcagctgatgagcctggcaggaggcgcagtggtgctggccttggagggtggc
catgacctcacagccatctgtgatgcctctgaggcctgtgtggctgctcttctgggcaac
aaggtggatcccctttcagaagaaggctggaaacagaaacccaacctcaacgccatctgc
tctctggaggccgtgatccgggtgcacagtaaatactggggatgcatgcagcgcctggct
tcttgtccagactcctgggtgcctcggccgccaggagctgacaaagaagaagtggaggca
gtgaccgcactggcatccctctctgtgggcatcctggctgaagacaggccctcggagcag
ctggtggaggagaagaacctatga

DBGET integrated database retrieval system