KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402258Help
Entry
100402258         CDS       T03264                                 

Gene name
PPP1CC
Definition
(RefSeq) protein phosphatase 1 catalytic subunit gamma
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03015  mRNA surveillance pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04114  Oocyte meiosis
cjc04218  Cellular senescence
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04390  Hippo signaling pathway
cjc04510  Focal adhesion
cjc04611  Platelet activation
cjc04720  Long-term potentiation
cjc04728  Dopaminergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04810  Regulation of actin cytoskeleton
cjc04910  Insulin signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04931  Insulin resistance
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
cjc05168  Herpes simplex virus 1 infection
cjc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100402258 (PPP1CC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100402258 (PPP1CC)
   04024 cAMP signaling pathway
    100402258 (PPP1CC)
   04022 cGMP-PKG signaling pathway
    100402258 (PPP1CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100402258 (PPP1CC)
   04218 Cellular senescence
    100402258 (PPP1CC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100402258 (PPP1CC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100402258 (PPP1CC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100402258 (PPP1CC)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100402258 (PPP1CC)
   04921 Oxytocin signaling pathway
    100402258 (PPP1CC)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100402258 (PPP1CC)
   04270 Vascular smooth muscle contraction
    100402258 (PPP1CC)
  09156 Nervous system
   04728 Dopaminergic synapse
    100402258 (PPP1CC)
   04720 Long-term potentiation
    100402258 (PPP1CC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100402258 (PPP1CC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100402258 (PPP1CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    100402258 (PPP1CC)
   05034 Alcoholism
    100402258 (PPP1CC)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100402258 (PPP1CC)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100402258 (PPP1CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100402258 (PPP1CC)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cjc03021]
    100402258 (PPP1CC)
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100402258 (PPP1CC)
   03041 Spliceosome [BR:cjc03041]
    100402258 (PPP1CC)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100402258 (PPP1CC)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100402258 (PPP1CC)
Transcription machinery [BR:cjc03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100402258 (PPP1CC)
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100402258 (PPP1CC)
Spliceosome [BR:cjc03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100402258 (PPP1CC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 100402258
NCBI-ProteinID: XP_002753051
Ensembl: ENSCJAG00000009147
UniProt: U3D630
LinkDB All DBs
Position
9
AA seq 337 aa AA seqDB search
MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRVTSDLNPSIQKASNYRNNTVLYE
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttagataaactcaacatcgacagcatcatccaacggctactggaagtgaga
gggtccaagcctggtaagaatgtccagcttcaggagaatgaaatcagaggactgtgctta
aagtctcgtgagatctttctcagtcagcctatcctgctagaacttgaagcaccactcaaa
atatgtggtgacatccatgggcaatactatgatttgctgcgactttttgagtatggtggt
ttcccgccagaaagcaactacctgtttcttggggactatgtggacaggggaaagcagtca
ttggagacaatctgcctcttactggcctacaaaatcaaatatcctgagaatttttttctt
ctcagagggaaccatgaatgtgccagcatcaacagaatttatggattttatgatgaatgt
aaaagaagatacaacattaaattatggaaaactttcacagactgttttaactgtttaccg
atagcagccatcgtggatgagaagatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgcgaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggatatgaattttttgcaaag
aggcagttggtcactctgttttctgcacccaattattgtggagagtttgacaatgcaggt
gccatgatgagtgtggacgaaacactaatgtgttcttttcagattttaaagcctgcagag
aaaaagaagccaaatgccacgagacctgtaacacctccaagggttacatcagacctgaac
ccgtccattcagaaagcttcaaattatagaaacaatactgttctatacgagtga

DBGET integrated database retrieval system