KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402387Help
Entry
100402387         CDS       T03264                                 

Gene name
ATM
Definition
(RefSeq) ATM serine/threonine kinase
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc03440  Homologous recombination
cjc04064  NF-kappa B signaling pathway
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04218  Cellular senescence
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05202  Transcriptional misregulation in cancer
cjc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100402387 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100402387 (ATM)
   04068 FoxO signaling pathway
    100402387 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100402387 (ATM)
   04210 Apoptosis
    100402387 (ATM)
   04115 p53 signaling pathway
    100402387 (ATM)
   04218 Cellular senescence
    100402387 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100402387 (ATM)
   05206 MicroRNAs in cancer
    100402387 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100402387 (ATM)
   05170 Human immunodeficiency virus 1 infection
    100402387 (ATM)
   05165 Human papillomavirus infection
    100402387 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100402387 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100402387 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100402387 (ATM)
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100402387 (ATM)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100402387 (ATM)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100402387 (ATM)
DNA replication proteins [BR:cjc03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     100402387 (ATM)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    100402387 (ATM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC Uso1_p115_head ANAPC5
Motif
Other DBs
NCBI-GeneID: 100402387
NCBI-ProteinID: XP_002807314
Ensembl: ENSCJAG00000010159
LinkDB All DBs
Position
11
AA seq 3057 aa AA seqDB search
MSLALNDLLICCRHLEHDRATERKKEVEKFKRLIRDPETIKHLDRHSDSKQGKYLNWDAV
FRFLQKYIQKETECLRLAKPNVSASTQASRQKKMQEISSLVKYFIKCANKRAPRLKCQEL
LNYIMDTVKDSSNGAIYGADYSNILLKDILSVRKYWCEISQQQWLELFSVYFRMYLKPSQ
DVQRVLVARIIHTVTKGCCSQTDGLNSRFLDFFSKAIQCARQEKSSSGLNHILAALIIFL
KTLAANSRIQVCELGDEILPTLLYIWTQHRLNDSLKEVIIELFELQIYIHHPKGAKTQEK
GAYESTKWKSILYNLYDLLVNEISHIGSRGKYSSGFRNIAVKENLIELMADICHQVFNED
TRSLEISQSYATTQRESSDDSVPCKRRKIDLGWEVIKDHLQKSQNDFELVPWLQITTQLI
SKYPASLPNCELSPLLMILCQLLPQQRRGERTPYVLRCLMEVALCQNKRSNLESSQKSDL
LKLWNKIWCITFRGISSEQIQAENFGLLGAIIEGSLVEVDREFWKLFTGSACRPSLCPAI
CCLTLALTTIIVPETVKMGIEPNICEVNKSFSLKESIMRWLLFYQLEDDLENSTEVPPIL
HSNFPHLVLEKILVSLTMKNCKAAVNFFQSAPECEQHQRDKEEPSFSEVEELFLQTTFDK
MDFLTAVRECAIEKHQSSIGFSVHQNLKESLVRYLLGLSEQLLNSYSSEITNSEMLVRCS
VLLVGVLGCYCYMGVITEDEAYKSELFQKAKSLMQCAGESITLFKNKTNEEFRIGSLRNI
MYLCTRSLSNCTKKSPSKIASGFFLRLLTSKLMNDIADICKTLAFTIKKPFDHGDVESME
DDTNGNLMEVEDQSSMTLFDDYPDSSVSDANEPGESQSTIGAINPLAEEYLSKQDLLFLD
MLKFLCLCVTAVQTNAVSFRAADIRRKLLMLIDSSTLDPTKSLHLHMYLMLLKELPGKEY
PLPMEDVIELLKPLSNVCSLYRRDQDVCKTILNHVLHIVRNLGQSNMDSENTRDAQGQFL
TVIGAFWHLTKEKKYTFSVRMALVECLKCLLEADPYSKWAVLHVVGEDFPVNEVFTQFLA
DNHHQVRMLAAKSINRLFQDTKRDSSRLLKALPLKLQQTAFQNAYLKAQEGMREMSHGAE
NPEALDEIYNRKSVLLMLIAVVLSCSPICEKQALFALCKSVKESGLEPHLVKKVLEKVSE
TFGYRCLEDFMASHLDYLVLEWLNLQDTEYSLSSFPFILLNYTNIEDFYRSCYKILIPHL
VIRSRFDEVKCIANQIQEDWKSLLTDCFPKILVNILPYFAYEGTGDSGMAQQRETATKVY
DMLKSENLLGKQIDHLFISNLPEIVVELLMTLHEPADSGASQSTDLCDFSGDLDPAPNPP
HFPSHVIKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQAAETNNVYKKHRIL
KIYHLFVSLLLKDIKSGLGGAWAFVLRDVIYTLIHYINQRPSRIMDVSLRSFSLCCDLLS
QVCQTAVTYCKDALENHLHVVVGTLIPLVDEQVEIQKQVLDLLKYLVIDNKDNENLYLTI
KLLDPFPDHVVFKDLRITQQKIKYSRGPFSLLEEINHFLSVSVYDALPLTRLEGLKDLRR
QLELHKDQMMDIMRASQDHPQDGIMVKLVVNLLQLSKMAINHTGEKEVLEAVGSCLGEVG
PIDFSTIAIQHSKDASYTKALELFEDKELQWTFIMLTYLNNTLVEDCVKVRSAAVTCLKN
ILATKTGHSFWEIYKMTTDPMLAYLQPFRTSRKKFLEVPRFEKENPFEGLDDINLWIPLC
ENHNIWIKTLTCAFLDSGRTKSEILQLLKPMCEVKTDFCQTVLPYLIHDILLQDTNESWR
NLLSTHVQGFFTSCLRHFSQTSRSTTPANLDSESEHVFRCCLDKKSQRTMLAVVDYMRRQ
KRPSSRTIFDDAFWLDLNYLEVAKVAQSCAAHFTALLYAEIYADKKSMDDQEKRNLAFEE
GSQCTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPITRLRTYEHE
AMWGKALVTYDLETAISSSTRQAGIIQALQNLGLCHILSVYLKGLDYENKDWCPELEELH
YQAAWRNMQWDHCSSANKEIEGASYHESLYSALQSLRDKEFSTFYESLKYARVKEVEELC
KGSLESVYSLYPTLSRLQAIGELESIGDLFSRSVTHRQLSEVYVKWRKHSQLLKDTDFSF
QEPLMALRTVVLEILLEKEMENSERECFKDILTKHLVELSILARTFKNTQLPERAIFQIK
QYNSVSCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCTENNPSLKLIYTECLR
VCGNWLAETCLENPAVIMQTYLEKAVEVAGNYDGESNDELRNGKMKAFLSLARFSDTQYQ
RIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDECALRALKEDR
KRFLCKAVENYINCLLSGEEHDTWVFRLCSLWLENSGVSEVNGMMKRDGMKIPSYKFLPL
MYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANKDEFLTKPEVAR
RNRITKNAPKQSSQLDEDRTEAANRIIHTIRSRRPQMIRSVEALCDAYIRLANLDASQWK
TQRKGINIPADQPITKLKNLEHVVVPTMEIKVDPTGEYGNLVTVQSFRAEFRLAGGVNLP
KIIDCVGSDGRERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTYKVVP
LSQRSGVLEWCTGTVPIGEFLVNNEDGAHKRYRPNDFSALQCQKKMMEVQKMSSEEKYET
FMDICQNFQPVFRYFCMEKFLDPAIWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILIN
EQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMR
NSKETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDETELHSTLNADDQECKRNLSDTD
QSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAWV
NT seq 9174 nt NT seq  +upstreamnt  +downstreamnt
atgagtctagcacttaatgatctgcttatttgctgccgtcatctagaacatgatagagct
acagaacgaaagaaagaagttgagaaatttaagcgcctgattcgagatcctgaaacaatt
aaacatttagatcgacattcagattccaaacaaggaaaatatttgaattgggatgctgtt
tttagatttttacagaaatatattcagaaagaaacagaatgtctgagactggcaaaacca
aatgtatcagcctcaacacaagcctccaggcagaaaaagatgcaggaaatcagtagtttg
gtcaaatacttcatcaaatgtgcaaataaaagagcacctaggctaaaatgtcaagaactc
ttgaattatatcatggatacagtgaaagattcatctaatggtgccatttatggagctgat
tatagcaacatactactcaaagacattctttctgtgagaaaatactggtgtgaaatatct
cagcaacagtggttagaattgttctctgtgtacttcaggatgtatctgaaaccttcacaa
gatgttcagagagttttagtggctagaataattcatactgttactaaaggatgctgttct
cagactgatggattgaattccagatttttggatttcttttccaaggccattcagtgtgcg
agacaagaaaagagctcttcaggtttgaatcatattttagcagctcttattatcttcctc
aagactctggctgccaactctcgaattcaagtgtgtgaattaggagatgaaattcttccc
accttgctttatatttggactcaacatagacttaatgattctctaaaagaagtcattatt
gaattatttgaactgcaaatttatatccatcatccaaaaggagccaaaacccaagaaaaa
ggtgcttatgaatcaacaaaatggaaaagtattttatacaacttatatgatctgctagtg
aatgagataagtcatataggaagtagaggaaagtattcttcaggatttcgtaatattgcc
gtgaaggaaaatttgattgaattgatggcagacatttgtcaccaggtttttaatgaagat
accagatccttggagatttctcagtcttatgctactacacaaagagaatctagtgatgac
agtgtgccttgcaaaaggaggaaaatagatctaggctgggaagtaataaaagatcacctt
cagaagtcacagaatgattttgaacttgtgccatggctacagattacaacccaattaata
tcaaagtatcctgcaagtttacctaactgtgagctgtctccattactgatgatactctgt
cagcttctacctcaacagcgacgtggggaacgcacaccatatgtgttgcgatgtcttatg
gaagttgcgttgtgtcagaacaagaggtcaaacctagaaagctcacaaaaatcagattta
ctgaaactctggaataaaatttggtgtattacctttcgtggtataagttctgagcaaata
caagctgaaaactttggcttacttggagccataattgaaggtagtttagttgaggttgac
agagaattctggaagttatttactgggtcagcctgcagaccttccctgtgtcctgcaata
tgctgcttgactttggcactgaccaccattatagttccagaaacagtaaaaatgggaata
gagccaaatatatgtgaagtaaataaaagcttttctttaaaggaatcaataatgagatgg
ctcttattctatcagctagaggatgacttagaaaatagtacggaagtgcctccgattctt
cacagtaattttcctcatctcgtactggagaaaattcttgtgagtctgactatgaaaaac
tgtaaggctgcagtgaattttttccaaagtgcgccagaatgtgaacaacaccaaagagat
aaagaagaaccttcattttcagaagtagaagaactgtttcttcagacaacttttgacaag
atggactttttaactgctgtgagagaatgtgctatagaaaagcaccaatctagtattggc
ttttctgtccaccagaatctcaaggaatcactggttcgctatcttctgggattatcagaa
cagcttctaaatagttattcatctgagattacaaattcagaaatgcttgtccggtgttca
gttcttttggtgggtgtccttggctgctactgctatatgggtgtaataactgaagatgaa
gcatataagtcagaattattccagaaagccaagtctctaatgcaatgtgcaggagaaagt
atcactctgtttaaaaataagacaaatgaagaattcagaattggttccttgagaaatata
atgtatctatgtacacgttccttgagcaactgtaccaagaagagtccaagtaagattgcg
tctggctttttcctgcggttgttaacgtcaaagctaatgaatgatattgcagatatttgt
aaaactttagcattcacaatcaaaaagccatttgaccatggagatgtagaatcaatggaa
gatgatactaatggaaatctaatggaggtggaggatcagtcatccatgactctatttgat
gattaccctgatagtagtgttagtgatgcaaatgaacctggagagagccaaagtaccata
ggtgccattaaccctttagctgaagaatacctatcaaagcaagatctcctcttcttagac
atgctcaagttcctgtgtttgtgtgtaactgctgttcagaccaatgccgtgtcctttagg
gcagctgacattcggaggaagttgttaatgttaattgattctagcacgctagaccccaca
aaatctctccacttgcatatgtatctaatgcttttaaaggagcttcctggaaaagaatat
cccttgccaatggaagatgttattgaacttctgaaaccactatccaatgtgtgttctttg
tatcgtcgtgaccaagatgtctgtaaaacgattttaaaccatgtccttcatatcgtgaga
aacctaggtcaaagcaatatggactctgagaacacaagggatgctcaaggacagtttctt
acagtaattggagcattttggcatctaacaaaggagaagaaatatacattctctgtaaga
atggccctagtagaatgccttaaatgtttgcttgaggctgatccttactcaaagtgggct
gttcttcacgtggtgggagaagactttcctgtaaatgaagtatttacacagtttcttgct
gataatcatcaccaggttcgcatgttggctgccaagtcaatcaacagattattccaggac
acaaaacgagattcttccaggttactgaaagcacttcctttgaagcttcagcaaacagct
tttcaaaatgcatacttgaaagctcaggaaggaatgagagaaatgtcccatggcgctgag
aaccctgaagctttggatgaaatttataatagaaaatctgtcttactgatgttgatagcc
gtggttttatcctgtagccctatctgtgaaaaacaggctttgtttgctctatgtaaatct
gtgaaagaaagcggattagaacctcaccttgtgaaaaaggttttagagaaagtttctgaa
acgtttggatataggtgtttagaagactttatggcttctcatttagattatctggttttg
gaatggctaaatcttcaagatactgaatacagcttatcttcttttccttttattttatta
aactacacaaatattgaggatttctatagatcttgttataagattttgattccacatctg
gtgattcgaagccgttttgatgaggtgaagtgcattgctaatcagattcaagaggactgg
aaaagtcttctaacagactgctttccaaagattcttgtcaatattcttccttattttgcc
tatgagggtacaggagacagtgggatggcacagcaaagagagactgctaccaaagtctat
gatatgcttaaaagtgaaaacttactgggaaaacagattgatcatttattcatcagtaat
ttaccagaaattgtggtggagttattgatgacgttacatgagccagcagattctggtgcc
agtcagagcactgacctctgtgacttttcaggggatttggatcctgctcctaatccacct
cattttccatcgcacgtgattaaagccacatttgcctatatcagcaattgtcataaaacc
aagttgaaaagcattttagaaattctttccaaaagccctgattcctatcagaaaatactt
cttgccatatgtgagcaagcagctgagacaaataatgtttataagaagcacagaattctt
aaaatataccacctgtttgtcagtttattactgaaagatataaaaagtggcttaggagga
gcttgggcctttgttcttcgagatgttatttacactctgattcactatatcaaccaaagg
ccttctcgtatcatggatgtgtcattacgtagcttctccctttgttgtgacttactaagt
caggtttgccagacagcagtgacttactgtaaggatgctttagaaaaccatcttcatgtt
gttgttggtacacttataccccttgtggatgagcaggtggagattcagaaacaggtattg
gacctgttgaaatacttagtgatagataacaaggataatgaaaacctctatctcacgatt
aagcttttagatccttttcctgaccatgttgtttttaaagatttgcgtattactcagcaa
aaaatcaaatacagtagaggacccttttcactcttggaggaaattaaccattttctctca
gtaagtgtttatgatgcacttccattgacaagacttgaaggactgaaggatcttcggaga
caactggaactacataaagatcagatgatggacattatgagagcatctcaggatcatcca
caggatgggattatggtgaagctagttgtcaatttgttgcagttatccaagatggcaata
aaccacactggtgaaaaagaagttctagaggctgttggaagctgcttgggagaagtgggt
cctatagatttctctaccatagctatacaacatagtaaagatgcatcttataccaaggcc
cttgagttatttgaggataaagaacttcagtggaccttcataatgctgacctacctgaat
aacacactggtagaagattgtgtcaaagttcgatcagcagctgttacctgtttgaaaaac
attttagccacaaagactggacatagtttctgggagatttataagatgacaactgatcca
atgctggcctatctacagccttttagaacatcgagaaaaaagtttttagaagtacccaga
tttgaaaaagaaaacccttttgaaggcctggatgatataaatctgtggattcctctatgt
gaaaatcacaacatttggataaagacactgacttgtgcttttttggacagcggccgaaca
aaaagtgaaattcttcaattattaaagccaatgtgtgaagtgaaaactgacttttgtcag
actgtacttccatacttgattcatgatattttactccaagatacaaatgaatcatggaga
aatctcctttctacacatgttcagggatttttcacaagctgtcttagacacttctcacaa
acgagccgatccacaacgcctgcaaacttggattcagaatcagagcacgttttccgatgc
tgtctggataaaaagtcacagagaacgatgcttgctgttgtggactacatgagaagacaa
aagagaccttcttcaagaacaatttttgatgatgctttctggctggatttaaattatttg
gaagttgccaaggtagctcagtcttgtgctgctcactttacagctttactctatgcagaa
atctatgcagacaagaaaagcatggatgatcaagagaaaagaaatcttgcatttgaagaa
ggaagccaatgtacaactatttctagcttgagtgaaaaaagtaaagaagaaactggaata
agtttacaggatcttcttttagaaatctacagaagtataggagagccagatagtttgtat
ggctgtggtggagggaagatgttacagcccattactagactacggacatatgaacatgaa
gcaatgtggggcaaagccctagtaacatatgacctcgaaacagcaatctcctcatcaacg
cgccaggcaggaatcattcaggccttgcagaatttgggactctgccatattctttccgtc
tatttaaaaggattagattatgaaaataaagattggtgtcctgagttagaggaacttcat
taccaagcagcatggaggaatatgcaatgggaccactgcagttctgccaacaaagaaata
gaaggagccagttaccatgaatcattgtacagtgctctgcagtctctaagagacaaagaa
ttctctacattttatgaaagtctcaaatatgccagagtaaaagaagtggaagagttgtgt
aagggcagccttgagtctgtgtattcgctctaccccacacttagcaggttgcaggccatt
ggagagctggagagcattggggaccttttctcaagatcagtcacacatagacaactctct
gaagtatacgttaagtggcggaaacactcccagcttctcaaggacacggattttagtttt
caggagcctctcatggctctgcgcacagtcgttttggagatcctgctggaaaaggaaatg
gagaactcagagagagaatgttttaaggacattctcaccaaacaccttgtagaactctct
atactggccagaactttcaagaacactcagctccctgaaagggcaatatttcaaattaaa
cagtataattcagttagctgtggagtctctgagtggcagctggaagaagcacaagtattc
tgggcaaaaaaggagcagagtcttgccctgagtattctcaagcaaatgatcaagaagttg
gatgccagctgtacagagaacaatcccagcctaaaacttatatacacagaatgtctaagg
gtttgtggcaactggctagcagaaacttgcttagaaaatcctgcagtcatcatgcagacc
tatctagaaaaggcagtagaagttgctggaaattatgatggagaaagtaatgatgagcta
agaaatggaaaaatgaaggcatttctctcattagcccggttttcagatactcagtaccaa
agaattgaaaactacatgaaatcatcagaatttgaaaacaaacaagctctcctgaaaaga
gccaaagaggaagtaggtctccttagggaacataaaattcagacaaacagatacactgta
aaggttcagcgagagctggagctggatgaatgtgccctgcgagcactgaaagaggatcgt
aaacgcttcttatgtaaagcagttgaaaactacatcaactgcttattaagtggagaagaa
catgacacgtgggtgttccgactttgttccctctggcttgaaaattctggagtttctgag
gtcaatggcatgatgaagagagatggaatgaagattccatcctataaatttttgcctctt
atgtaccaattggctgctagaatggggaccaagatgatgggaggcctaggatttcatgaa
gtcctcaataatctaatctctagaatttcaatggatcacccccatcatactttgtttatt
atactggccttagcaaatgcaaacaaagatgaatttctgactaaaccagaggtagcaaga
agaaacagaataactaaaaatgctcctaaacaaagctctcagcttgatgaggatcgaaca
gaggctgcaaacagaataatacatactatcagaagtaggagacctcagatgatcagaagt
gttgaggcactttgtgatgcttatattagattagcaaacttagatgcctctcagtggaag
actcagagaaaaggcataaacattccagcagaccagccaattactaaacttaagaattta
gaacatgttgttgtccctactatggaaattaaggtggaccccacaggagaatatggaaat
ctggtgactgtacagtcatttagagccgaatttcgcttagcaggaggtgtaaatttacca
aaaataatagactgtgtgggttccgatggcagggaaaggaggcagctggtcaagggccgt
gatgacctgagacaagatgctgtcatgcaacaggtcttccagatgtgtaatacattactg
cagagaaacacggaaactaggaagaggaaattaactatctgtacttataaggtggttccc
ctctctcagcgaagtggtgttcttgagtggtgcacaggaactgtccctattggtgaattt
cttgttaacaatgaagatggtgctcataaaagatacaggccaaatgatttcagtgcctta
cagtgccagaagaaaatgatggaggtgcaaaaaatgtcttctgaagagaaatatgaaacc
ttcatggatatttgccaaaattttcaaccagttttccgttatttctgcatggaaaaattc
ttggatccagctatttggtttgagaagcgactggcttatacgcgcagtgtagccacttct
tcgattgttggttacatacttggacttggtgatagacatgtacagaatatcttaataaat
gagcagtcagcagaacttgtacatatagatttaggtgttgctttcgaacagggcaaaatt
cttcctactcctgagacagttccttttagactcaccagagatattgtggatggcatgggc
attactggtgttgaaggtgtcttcagaaggtgctgtgagaaaaccatggaagtgatgaga
aactctaaggaaactctgttaaccattgtagaggtccttctgtatgatccactctttgac
tggaccatgaatcctttgaaagctttgtatttacagcagaggccagaggatgaaactgag
cttcactctactttgaatgcagatgaccaagaatgcaaacgaaacctcagtgatactgac
cagagtttcaacaaagtagctgaacgtgtgttaatgagactccaggagaaactgaaagga
gtggaagaaggcactgtgctcagtgttggcgggcaagtgaacctgctcatccagcaggcc
atggaccccaaaaatctcagccgacttttcccaggatggaaagcgtgggtgtga

DBGET integrated database retrieval system