KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402574Help
Entry
100402574         CDS       T03264                                 

Gene name
TGM6
Definition
(RefSeq) transglutaminase 6
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100402574 (TGM6)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100402574 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core TRAP_beta
Motif
Other DBs
NCBI-GeneID: 100402574
NCBI-ProteinID: XP_008993887
Ensembl: ENSCJAG00000020966
LinkDB All DBs
Position
5
AA seq 706 aa AA seqDB search
MAGIRVTKVDWQRLRNGAAHHTQEYPCPELVIRRGQSFSLTLELSRDPDCEETLIFTVET
GPRASEALHTKAVFQTSELDGGEGWTAAKEAQMENTLTVSLTSPPNAVIGRYLLSTRLSS
HRKHSNRRLGEFILLFNPWCAEDDVFLASEEERQEYVLNDSGIIFRGVEKHIRAQGWNYG
QFEEDILNICLSILDRSPSHQDNPATDVSCRHDPIYVTRVISAMVNSNNDQGVVQGQWQG
RYGGGTSPLHWRGSVAILQKWFKGRHKPVKYGQCWVFAGVMCTVLRCLGIATRVVSNFNS
AHDTDQNLSVDKYVDFFGRTLEDLTEDSMWNFHVWNESWFARQDLGPSYNGWQVLDATPQ
EESEGVFRCGPASVAAIREGDIHLAHDGPFVFAEVNADYITWLWHEDESRERVYSDTKKI
GRCISTKAVGSDLRVDITGLYKYPEGSRKERQVYSKAVKRLFSVEASGRRTQIRRAGGRC
LRRDDLLEPATKPSITGKFKVLEPPMLGHDLRLALCLANLTSRAQWVRVNLSGATILYTR
KPVAEILHESHTVRLGPKEEKRIPIAISYSKYKEDLTEDKKILLAAMCLVTKGEKLLVEK
DITLEDFITIKVLGPAVVGVAVTVEVTVVNPILERVKDCALMVEGSGLLQGQLSINVPTL
EPQERTSVQFDITPSKSGARQLQVDLVSPHFPDVKGFVIIHVATTK
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggcagggatcagagtcaccaaggtggactggcagcggttgaggaatggcgctgcccac
cacacccaggagtacccctgccctgagctggtgattcgcaggggccagtcattcagcctc
acactggagctgagcagagacccggactgcgaggagaccctgatcttcacggtggagaca
ggaccccgggcttctgaggccctccacaccaaagctgtgttccagacatcggagttggat
gggggtgagggctggacagcagcaaaggaggctcagatggagaacactctgaccgtcagt
ctcaccagccctcccaatgctgtcattggccgctacctgctgagcaccaggctttcctct
caccgcaaacacagcaaccggaggctgggggagtttattctccttttcaacccatggtgc
gcagaggacgatgtatttctggcctcagaggaggagagacaggagtacgtgctcaatgac
agcggcataatcttccgaggcgtggagaagcacatccgagcccagggctggaactacggg
cagtttgaggaggacatcctgaacatctgcctctccatcctggatcgaagccccagtcac
caagacaacccagccactgacgtgtcctgccgccatgatcccatctatgtcaccagggtc
atcagcgccatggtgaacagcaacaatgaccaaggtgtggtgcaaggacagtggcagggc
aggtacggcggcggcaccagcccactgcactggcgcggcagcgtggccattctgcagaag
tggttcaagggcaggcacaagccagtcaagtacggccagtgctgggtcttcgccggagtc
atgtgcacagtcctcaggtgcttggggatagccacacgggtcgtgtccaacttcaactca
gcccacgacacagaccagaacctgagtgtggacaaatacgtggacttcttcgggcggacc
ctggaggacctgacagaagacagcatgtggaatttccatgtctggaatgagagctggttt
gcccggcaggacctcggcccctcttacaatggttggcaggttctggatgccacccctcag
gaggagagtgaaggtgtgttccggtgcggcccagcctcagtcgccgccatccgtgagggc
gacatacacctggcccatgatggcccctttgtgtttgcggaggtcaacgccgactacatc
acctggctgtggcatgaggatgagagccgggagcgtgtgtattcggacacaaagaagatc
gggagatgcatcagcaccaaggcagtaggcagcgacttgcgcgtggacatcactggcctc
tacaagtatccagaagggtcccggaaagagaggcaggtgtatagcaaggcagtgaagagg
ttgttcagcgtggaagcctctggaaggagaacccagatccgcagggctggggggcgctgt
ctccggcgtgacgacctcctggagcctgccaccaagcccagcatcactggcaagttcaag
gtgctagagcctcccatgctgggccacgacctgagactggccctgtgcttggccaacctc
acctcccgggcccagtgggtgagagtcaacctgagcggtgccaccatcctctacacccgc
aagccggtggcagagatcctgcacgaatcccacaccgtgaggctggggccgaaagaagag
aagagaatcccaattgcaatatcttactctaagtataaagaagacctaacagaggacaag
aagatcctgttggctgccatgtgccttgtcaccaaaggagagaagcttctggtagagaag
gacattactctagaggacttcatcaccatcaaggttctgggcccagccgtggtgggagtg
gcggttacagtggaagtgactgtagtcaatccgatcttagagagagtaaaggactgtgcg
ctgatggtggagggcagcggccttctccagggacagctcagcatcaacgtgcccaccctg
gagccccaggaaagaacttcagtccagtttgacatcaccccctccaagagtggcgcaagg
cagctgcaggtggaccttgtaagccctcacttcccagatgttaagggctttgtgattatc
catgtggccactacaaagtga

DBGET integrated database retrieval system