KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402629Help
Entry
100402629         CDS       T03264                                 

Gene name
INF2
Definition
(RefSeq) inverted formin, FH2 and WH2 domain containing
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
SSDB OrthologParalogGFIT
Motif
Pfam: FH2 Drf_FH3 Drf_GBD WH2 MbeD_MobD
Motif
Other DBs
NCBI-GeneID: 100402629
NCBI-ProteinID: XP_009004898
Ensembl: ENSCJAG00000009247
LinkDB All DBs
Position
10
AA seq 1282 aa AA seqDB search
MRSQGSVRSSPGQGLEWVGRGGRKVLRIWLGKMSVKEGAQRKWAALKEKLGPPDSDPTEA
NLENADPELCIRLLQMPSVVNYSGLRKRLEGSDGSWMVQFLEQSGLDLLLEALARLSGRG
VARISDALLQLTCVSCVRAVMNSQQGIGYILSNQGYVRQLSQALDTSNVMVKKQVFELLA
ALCIYSPEGHALTLDALDHYKTACSQQYRFSVVMNELSGSDNIPYVVTLLSVINAVILGP
EDLRTRTQLRNEFIGLQLLDVLARLRDLEDADLLIQLEAFEEAKAEDEEELLRVSGGVDM
SSHQEVFASLFHKVSCSPVSAQLLSVLQGLLHLEPSLRSSQLLWEALESLVNRAVLLASD
AQECSLEEVVERLLSVKGRPRPSPLVKAHKSVQANLGQSQRGSSPQHTATPKAGVEGQQP
AAPTCQPVDHAQSESLLKASQPRALEQRAPTPPPPVPLLPGSNAEPPPPPPPPPLPGVGT
EALLAPPPPPPPPLLGLGAMAPPAPPPPPPLPGACGILPPPPPPLPGMECPPPPPPLLPG
MGWGPPPPPPPPLPGTCSPSVAGDVEEVIVAQVDHGLGSAWVPSHRRVNPPTLRMKKLNW
QKLPSNVAREHNSMWASLSSSHAEAVEPDFSSIERLFSFPAAKPKEPTTAAAPARKEPKE
ITFLDAKKSLNLNIFLKQFKCSNEEVAAMIRAGDTTKFDVEVLKQLLKLLPEKHEIENLR
AFTEERAKLANADRFYVLLLAIPCYQLRIECMLLCEGAAAMLDMVQPKAQLVLAACKSLL
TSRRLPVFCQLILRIGNFLNYGSHTGDADGFKISTLLKLTETKSQQNRVTLLHHVLEEAE
KSHPDLLELPRDLEQPSKAAGINLEIIRSEASSNLKKLLETERKVSASVAEVQEQYAQRL
QASISAFRALDELFEAIEQKQRELADYLCEDAQQLSLEDTFSTMKAFRELFLRALKENKD
RKEQAATAERRKRQLAEEEARRPRGEDGKPVRKGPMKQEEVCVIDALLADIRKGFQLRKT
ARGRGDTEGGSKVASVDPPRATEPAIVATGDPAGDPVDGMRCPTSEPSLDAAAASKSRAW
DLVDAGTHCPQPTLEQSGEGGPRPLERRSSWYVDASEDLTTEDTQCPQPSEGAWPVTLGD
AQALKPLKFSSTQRPAAGSSSQDAKDPTALLGVLQAEASSTSRGREDTVHSRSVRPPTAG
PGGNRDEDEEDTAPESALDTSLDRSFSEDAVTDSSGSGTLPRSRGRASKGTSKRRKKRPS
RSQEEVAPDSDANKTERLCVIN
NT seq 3849 nt NT seq  +upstreamnt  +downstreamnt
atgagaagccaggggagcgtgaggagcagcccggggcagggcctagagtgggtgggcaga
ggcggccggaaggtcctgcgcatctggctcggcaagatgtcggtgaaggagggcgcacag
cgcaagtgggcagcgctgaaggagaagctggggccgccggactcagaccccacggaggcc
aacctggagaacgcagaccccgagctctgcatccggctgctgcagatgccctctgtggtc
aactactcgggcctgcgcaagcgcctggagggcagtgacggcagctggatggtgcagttc
ctggagcagagcggcctggacctgctgctcgaggcgctggcgaggctgtcgggccgcggc
gtcgcgcgcatctcggacgccctcctgcagctcacctgcgtcagctgcgtgcgcgccgtc
atgaactcacagcagggcatcgggtacatcctcagcaaccagggctacgtgcgccagctc
tcccaggccctggacacatccaacgtgatggtgaagaagcaggtatttgaactactggct
gccctatgcatctactcacccgagggccacgcactgaccctggacgccctggaccactat
aagacggcgtgcagccagcagtaccgcttcagcgtggtcatgaatgagctctctggcagc
gacaacataccctatgtggtcaccctgctcagcgtgatcaatgcagtcatcctgggcccc
gaggacctgcgcacacgcacccagctgcggaacgagtttatcgggctgcaactgctggac
gtcctggctcgtctgcgagacctggaggatgccgacctgctgatccagctggaggccttt
gaggaggccaaggccgaggacgaggaggagctgcttagagtctccggtggggtcgacatg
agcagccaccaggaggtctttgcctccctgttccacaaggtgagctgctccccggtgtct
gcgcagctcctgtctgtgctgcagggcctcctgcacctggagcccagcctccgctccagc
cagctgctctgggaggccctggagagcctggtgaaccgggccgtgctcttggccagtgac
gcccaggagtgcagcctggaggaagtggttgagcggctcctgtccgtcaaggggcggccc
cgaccaagcccgctggtcaaggcccataagagtgtccaggccaacttaggccagagccag
aggggcagctccccgcaacacactgcaacccccaaggccggcgtggagggccaacagcca
gcagcccccacctgccagcctgtggaccatgcccagagcgagagcctcctgaaagcttcg
cagccaagagccctggagcagcgggcgcccaccccgcccccacctgtacccctgctccct
ggatccaatgctgagccccctccccctcccccaccaccccccctgcccggtgtggggact
gaggccctcctagcaccacctccacccccacccccacccctgctaggcctgggggccatg
gcccccccagcaccccctccaccaccacccctgccaggtgcttgtgggatcctaccccca
ccacctccaccactcccgggcatggaatgcccacccccacccccacctctgctgcctggt
atgggctggggccctcctccacccccacctccaccactgcctggcacctgcagcccctca
gtggcaggagatgtggaggaggtcattgtggcccaggtggaccacggcttgggctcagcc
tgggtccccagccatcggcgggtgaacccacccacactgcgcatgaagaaactgaactgg
cagaagctgccatccaatgtggcccgtgagcacaactccatgtgggcgtccctgagcagt
tcccacgcagaggccgtggagcccgacttctccagcatcgagcggctcttctccttccct
gcagccaagcccaaggagcccaccacagcagctgccccagccaggaaggagcccaaggag
atcaccttccttgatgccaagaagagcctgaacctcaacatcttcctgaagcaatttaag
tgctccaatgaggaggtggctgctatgatccgggctggggacaccacgaagtttgacgtg
gaggttctcaaacagctccttaagctccttccggagaagcacgagattgaaaacctgcgg
gccttcacagaggagcgagccaagctggccaacgccgaccggttctacgtcctccttctg
gccattccctgctaccagctgcgaatcgagtgcatgctgctgtgcgagggcgcggccgcc
atgctggacatggtccagcccaaggcccagctggtgctggctgcctgcaaaagcctgctc
accagccgccggctgcctgtcttctgccagctgatcctgaggattgggaacttcctcaac
tatggcagccacaccggtgacgccgacggcttcaagatcagcacattgctgaagctcaca
gaaaccaagtcccagcagaaccgcgtgacactgctgcaccatgtgctggaggaagcagaa
aagagccaccccgacctcctggagctgccccgggacctggagcagccttcgaaagcagca
gggatcaacctggagatcatccgctcagaggccagctccaacctgaagaagcttctggag
acggagcggaaggtgtctgcctcggtggccgaggtccaggagcagtacgcccagcgcctc
caggccagcatctcggccttccgggcactggacgagctgtttgaggccattgagcagaag
cagcgggagctggctgactacctgtgtgaggacgcccagcagctgtctctggaggacacg
ttcagcaccatgaaggccttccgggaactcttcctccgcgccctgaaggagaacaaggac
cggaaggagcaggcggccacggcagagaggaggaagcggcagctggcggaggaagaggca
cggcggcctcggggagaggacgggaagcctgtcaggaaggggcccatgaagcaggaggag
gtgtgtgtcattgacgctctgctggctgacatcaggaagggcttccagcttcggaagacg
gcccggggccgcggggacaccgaggggggcagcaaggtggcctccgtggatcccccaagg
gccacagagcccgccatagtggccactggcgaccctgcaggagaccctgtggatggcatg
cgctgccccacctctgagcccagccttgatgctgcagcggccagcaagtcccgggcctgg
gaccttgtggacgccgggacccactgccctcagcccaccctggagcagtcgggggagggt
ggtccccggcccctggagaggcgttcttcctggtacgtggatgccagtgaggacctaacc
accgaggacacccagtgcccccagccctcagagggagcctggccagtgactctgggagat
gctcaggccctgaagcccctcaagttctccagcacccagcgtccggcagccggaagctca
agccaggatgccaaggatcccactgccttgctgggcgtcctccaggctgaagccagcagc
acgagccgggggcgggaggacactgtccacagccgcagtgtcagaccccctacggcaggc
ccgggcggaaacagggatgaggacgaggaggacacagccccagagtccgcgctggacaca
tccctagacaggtccttctccgaggatgcggtgaccgactcctcggggtccggcacactc
cccaggtcccggggccgggcctcaaaggggaccagcaagcgaaggaagaagcgcccctca
aggagccaggaagaggttgcccctgattctgatgctaataaaacggaaagactgtgtgtg
atcaactaa

DBGET integrated database retrieval system