KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402965
Entry
100402965         CDS       T03264                                 

Gene name
ERBB4
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 4
  KO
K05085  receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04020  Calcium signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc05014  Amyotrophic lateral sclerosis
cjc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100402965 (ERBB4)
   04012 ErbB signaling pathway
    100402965 (ERBB4)
   04020 Calcium signaling pathway
    100402965 (ERBB4)
   04151 PI3K-Akt signaling pathway
    100402965 (ERBB4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100402965 (ERBB4)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100402965 (ERBB4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100402965 (ERBB4)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100402965 (ERBB4)
Protein kinases [BR:cjc01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100402965 (ERBB4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH DUF3951
Other DBs
NCBI-GeneID: 100402965
NCBI-ProteinID: XP_008997667
Ensembl: ENSCJAG00000011307
UniProt: F7HB76
LinkDB
Position
6
AA seq 1308 aa
MKPATGLWVWVSLLVVAGTVQPSASQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM
GNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVST
NGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSG
PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCT
KINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFST
INQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYD
GEFREFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGA
NSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGG
LFILVIVGLTFAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKR
VKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHL
VRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQ
SDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMID
ADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAE
EYLVPQAFNIPPPIYTSRARIDSNRSEIGHSPPPAYTPMSGNQFVYRDGGFAAEQGVSVP
YRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERS
PRGELDEEGYMTPMRDKAKQEYLNPVEENPFVSRRKNGDLQALDNPEYHNASNGPSKAED
EYVNEPLYLNTFANALGKAEYLKNNVLSVPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQ
EYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV
NT seq 3927 nt   +upstreamnt  +downstreamnt
atgaagccggcgacaggactttgggtctgggtgagccttctcgtggtggcagggaccgtc
cagcccagcgcttctcagtcagtgtgtgcaggaacagaaaataaactgagttctctctct
gacctggaacagcagtaccgagccttgcgcaagtactatgaaaactgtgaggttgtcatg
ggcaacctggagataaccagcattgagcacaaccgggacctctctttcctgcggtctgtt
cgagaagtcacaggctacgtgttagtggctcttaatcagtttcgttacctgcctctggag
aatttacgcattattcgtgggacaaaactttatgaggaccgatatgccttggcaatattt
ttaaactacagaaaagatggaaactttggacttcaagaacttggattaaagaacttgaca
gaaatcctaaatggtggagtctatgtagaccagaacaaattcctttgttatgcagacacc
attcattggcaagatattgttcggaatccatggccttccaacttgactcttgtgtcaaca
aatggtagttcaggatgtggacgttgccataagtcctgtactggccgttgctggggaccc
acagaaaatcattgccagactttgacaaggacggtgtgtgcagaacaatgtgacggcaga
tgctacggaccctacgtcagtgactgctgccatcgagaatgtgctggaggatgctcagga
cctaaggacacagactgtttcgcctgcatgaatttcaatgacagtggagcatgtgttact
cagtgtccccagacctttgtctacaatccaaccacctttcaactggagcacaatttcaat
gcaaagtacacatatggagcattctgtgtcaagaaatgtccacataactttgtggtggat
tccagttcttgtgtgcgtgcctgccctagttccaagatggaagtagaagaaaatgggatt
aaaatgtgtaaaccttgcactgatatttgcccaaaagcttgtgatggcattggcacggga
tcactgatgtcagctcagactgtggattccagtaacattgacaaattcataaactgtacc
aagatcaatgggaatttgatctttttagtcactggtattcatggggacccttacaatgca
attgaagccatagacccagagaaactaaatgtctttcggacagtcagagagataacaggt
ttcttgaacatacagtcatggcccccaaacatgactgatttcagtgttttttctaacctg
gtgaccattggtggaagagtactctatagtggcctctccttgcttatcctcaagcaacag
ggcatcacgtctctgcagttccagtccctgaaggaaattagcgcaggaaacatctatatt
acagacaacagcaatctatgttattatcataccattaactggacaacactcttcagcaca
atcaaccaaaggatagtaatccgggacaatagaaaagctgaaaactgtactgccgaagga
atggtgtgcaaccatctgtgttcaagtgatggctgttggggacctgggccagaccaatgc
ctgtcgtgtcgtcgcttcagtagaggaaggatatgcatagagtcttgtaacctctatgac
ggtgaatttcgggagtttgagaatggctccatctgtgtggagtgtgacccccagtgtgag
aagatggaagatggcctcctcacatgccatggaccgggtcctgacaactgtacaaagtgc
tctcattttaaagatggcccaaactgtgtggaaaaatgtccagatggcttacagggggca
aacagtttcattttcaagtatgctgatccggatcgggagtgccacccatgccatccaaac
tgtacgcaagggtgtaacggtcccactagtcatgactgcatttactacccatggacgggc
cattccactttaccacaacatgctagaactcccctgattgcagctggagtaattggtggg
ctcttcattctggtcattgtgggtctgacatttgctgtttatgttagaaggaagagcatc
aaaaagaaaagagccttgagaagattcttggaaacagagttggtagaacctttaactccc
agtggcacagcaccgaatcaagcacaacttcgtattttgaaagaaactgagctgaagagg
gtaaaagtccttggctcaggtgcttttggaacagtgtataaaggtatttgggtaccggaa
ggagaaactgtgaagattcctgtggctattaagattcttaatgagacaactggtcccaag
gcaaatgtggagttcatggatgaagctctgatcatggcaagtatggatcatccacaccta
gttcggttgctgggtgtgtgtctaagcccaaccatccagctggttactcagcttatgccc
catggctgcctgttggagtatgtccatgagcacaaggataacattggatcacaactgctg
cttaactggtgtgtccagatagctaagggaatgatgtacctggaagaaagacggcttgtt
catcgggatttggcagcccgcaatgtcttagtgaaatctccaaaccatgtgaaaatcaca
gattttggactagccagactgttagaaggagatgaaaaagagtataatgctgatggagga
aagatgccaattaaatggatggctctggagtgtatacattacaggaaattcacccatcag
agtgacgtttggagctatggagttaccatatgggaactgatgacctttggaggaaaaccc
tatgatggaattccaactcgagaaatccctgatttattagagaaaggagaacgtttgcct
caacctcccatctgcactattgacgtttacatggtcatggtcaaatgttggatgattgat
gctgacagtagacccaaatttaaggaactggctgctgagttttcaaggatggctcgagac
cctcaaagatacctagttattcagggtgatgatcgaatgaagcttcccagtccaaatgac
agcaagttctttcagaatctcttggatgaagaagatttggaagatatgatggatgctgag
gagtacttggtccctcaggctttcaacatcccacctcccatttatacttccagagcaaga
attgactcaaataggagtgaaattggacacagccctcctcctgcctacacccccatgtca
ggaaaccagtttgtataccgagatggaggttttgctgcagaacaaggagtgtctgtgccc
tacagagccccaactagcacaattccagaagctcctgttgcacagggtgctacagctgag
atttttgatgactcctgctgtaatggcaccctacgcaagccagtggcaccccatgtccaa
gaggacagtagcactcagaggtacagtgctgaccccaccgtgtttgccccagaacggagc
ccacgaggagagctggatgaggaaggttacatgactcctatgcgagacaaagccaaacaa
gaatacctgaatccagtggaggagaacccttttgtttctcgaagaaaaaatggagacctt
caagcattggataatcccgaatatcacaacgcatccaatggtccatccaaggccgaggat
gagtatgtgaatgagccgctgtacctcaacacctttgccaatgccttgggaaaagctgag
tacctaaagaacaatgtactgtcagtgccagagaaggccaagaaagcgtttgacaaccct
gactactggaaccacagcttgccacctcggagcaccctccagcacccagactacctgcag
gagtacagcacaaaatatttttataaacagaatgggcggatccggcctattgtggcagag
aatcctgaatacctctctgagttctccctgaagccaggcactgtgctgccacctccacct
tacagacaccggaatactgtggtgtaa

DBGET integrated database retrieval system