KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403074Help
Entry
100403074         CDS       T03264                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00010  Glycolysis / Gluconeogenesis
cjc00030  Pentose phosphate pathway
cjc00051  Fructose and mannose metabolism
cjc00052  Galactose metabolism
cjc01100  Metabolic pathways
cjc01200  Carbon metabolism
cjc01230  Biosynthesis of amino acids
cjc03018  RNA degradation
cjc04152  AMPK signaling pathway
cjc05230  Central carbon metabolism in cancer
Module
cjc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100403074 (PFKP)
   00030 Pentose phosphate pathway
    100403074 (PFKP)
   00051 Fructose and mannose metabolism
    100403074 (PFKP)
   00052 Galactose metabolism
    100403074 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100403074 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100403074 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    100403074 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100403074 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100403074 (PFKP)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100403074 (PFKP)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100403074 (PFKP)
Messenger RNA biogenesis [BR:cjc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100403074 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100403074
NCBI-ProteinID: XP_002806987
Ensembl: ENSCJAG00000020417
LinkDB All DBs
Position
7
AA seq 784 aa AA seqDB search
MDADHSQGPKGSLRKLLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGSNIVEADWESVSSILQVGGTIIGSARCQAFRTRDGPPEGRRNLVQRGIT
NLCVIGGDGSLTGANLFRKEWSGLLEELAKNGQIEKEAVQRYAHLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKDLVVTQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLSGNHAVRLPLMEC
VQMTQDVQKAMDERRFQDAVQLRGKSFEGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGA
PAAGMNAAVRSAVRMGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTK
RVLPGKYLEEIATQMRMHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAKLKAARGRGKKFTTDDSVCVL
GISKRNVIFQPVAELKKETDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQ
PWSV
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggacgcggaccactcccagggccccaagggttccttgcggaaactcctggagcacctc
tccggagccggcaaggctatcggcgtgctgaccagcggcggggatgcccaaggtatgaat
gctgctgtgcgcgccgtagtgcgcatgggtatctacgtgggagccaaggtgtacttcatc
tatgagggctaccagggcatggtggatggaggctcgaacatcgtggaggccgactgggag
agcgtctccagcatcctgcaagtgggcgggacgatcatcggcagtgcgcggtgccaggcc
ttccgcacaagggatggcccgcctgaaggccgccgcaacctggtgcagcgtggcatcacc
aacctgtgtgtgattggcggggacgggagcctcaccggggccaacctcttccggaaggag
tggagtgggctgctggaggagctggccaagaacggccagatcgagaaggaggccgtgcag
aggtacgcccacctcaacgtggtgggcatggtgggatccatcgacaatgacttctgtggc
actgacatgaccatcggcaccgactcggccctgcacaggatcatcgaggtggtggatgcc
atcatgactacggcccagagccaccagaggaccttcgttctggaggtgatggggcgacac
tgtgggtacctggccctggtgagtgccttggcatgcggtgcagactgggtgttccttcca
gaatctccaccagaggaaggctgggaggagcagatgtgtgtgaaactctccgagaaccgt
gcccggaaaaaaaggctgaatattattattgtggctgaaggagcaattgacacccaaaat
aaacccattacctctgagaaaatcaaagaccttgtcgtcacgcagctgggctacgacaca
cgcgtgaccatcctcgggcacgtgcagagaggagggaccccttcggcattcgacaggatc
ttggcgagccgcatgggagtggaggcggtcatcgccctgctggaggccacccccgacact
ccagcttgtgtcgtgtctctgagtgggaaccacgctgtacgcctgccgctgatggagtgt
gtgcagatgactcaggatgtgcagaaggcgatggatgagcggaggtttcaggatgcggtt
caactccgggggaagagctttgagggcaacctgaacacctacaagcgacttgccatcaag
ctgccagatgatcagatcccaaagaccaattgcaacgtggctgtcatcaatgtgggggca
cctgcagctgggatgaatgcggctgtgcgctcagccgtgcgcatgggcatcgccgacggc
cacaggatgcttgccatctatgatggctttgacggctttgctaaaggccagatcaaagaa
atcggctggacagacgtcgggggctggaccggccagggaggctccattctcggaacaaaa
cgcgttctcccgggaaagtacttggaggagatcgccacacagatgcgcatgcacagtatc
aacgcgctgctgatcatcgggggatttgaggcctacctgggactcctggagctgtcagcc
gcccgggagaagcacgaggaattctgtgtccccatggtcatggttcccgccactgtgtcc
aacaatgtgcccggttccgatttcagcatcggggcagacacagctctgaatacgatcact
gacacatgcgaccgcatcaagcagtcagccagcgggaccaagcggcgcgtcttcatcatt
gagaccatggggggctactgcggctacctggccaacatgggagggctggcggctggagcc
gacgctgcgtacattttcgaggagcccttcgacatcagggacctacagtccaacgtggag
cacctgacagagaaaatgaagaccaccatccagaggggccttgtgctcagaaatgagagc
tgcagcgaaaactacaccaccgacttcatttaccagctctattcggaagagggcaaaggg
gtgtttgactgcaggaagaatgtgctgggccacatgcagcagggtggagcaccttctcca
tttgatagaaactttggaaccaaaatctctgccagagctatggagtggatcactgcgaag
ctcaaagcggcccggggcagaggaaaaaaatttaccactgatgattctgtttgtgtgctg
ggaataagcaaaagaaacgtcatttttcaacctgtggcagagctgaagaaggaaacggat
tttgagcacaggattcccaaagaacagtggtggctgaagctgcggcccctcatgaaaatc
ctggccaagtacaaggcgagctacgatgtgtcggactcaggccagctggagcacgtgcag
ccctggagcgtctga

DBGET integrated database retrieval system