KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403390
Entry
100403390         CDS       T03264                                 

Gene name
CCKAR
Definition
(RefSeq) cholecystokinin A receptor
  KO
K04194  cholecystokinin A receptor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04020  Calcium signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04911  Insulin secretion
cjc04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100403390 (CCKAR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100403390 (CCKAR)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100403390 (CCKAR)
  09154 Digestive system
   04972 Pancreatic secretion
    100403390 (CCKAR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100403390 (CCKAR)
G protein-coupled receptors [BR:cjc04030]
 Rhodopsin family
  Peptide
   Cholecystokinin
    100403390 (CCKAR)
SSDB
Motif
Pfam: 7tm_1 CholecysA-Rec_N 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100403390
NCBI-ProteinID: XP_002745977
Ensembl: ENSCJAG00000021028
UniProt: F7H5F1
LinkDB
Position
3
AA seq 429 aa
MDVVDSLLVNGSNISPPCELGLENETLFCLDQPHPSKEWQPAVQILLYSLIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPFTKNDNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
KFEASQKKSAKERKPSTSSSGRYEDSDGCYLQKSRPSRKLELRQLSTSSSSSRASRIRSS
SSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLS
YTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGVRGEVGEEEEGRTTGASLSRFSYS
HMSASAPPQ
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggatgtggtggatagccttcttgtgaatggaagcaacatctctcctccctgcgaactc
gggctcgaaaatgagacgcttttctgtttggatcagcctcatccttccaaagagtggcag
ccagcagtgcagattctcttgtactccttgatattcctgctcagcgtgctgggaaacacg
ctggtcatcaccgtgctgattcggaacaagcggatgcggacggtcaccaacatcttcctc
ctctccctggctgtcagcgacctcatgctctgcctcttctgcatgccgttcaacctcatc
cccaacctgctcaaggatttcatcttcgggagtgccgtttgcaagaccaccacctacttc
atgggcacctctgtgagtgtatctacctttaatctggtggccatatctctagagagatat
ggtgcgatttgcaaaccattgcagtcccgggtctggcaaacgaagtcccatgctttgaag
gtgattgctgctacctggtgcctttcgtttaccatcatgactccgtaccccatttacagc
aacttggtgccttttaccaaaaacgacaaccagactgcgaatatgtgccgctttctactg
ccaaatgatgttatgcagcagtcctggcacacgttcctgttactcatcctctttctcatt
cccggaattgtgatgatggtggcatatggcttaatctctttggaactctaccagggaata
aaatttgaggctagccagaagaaatctgctaaagaaaggaaacccagcaccagtagcagc
ggcagatatgaggacagcgatgggtgctacctgcagaagtccaggccttcgaggaagctg
gagctccggcagctgtccaccagcagcagcagcagcagggccagccgcatccggagcagc
agctccgcggccaacctgatggccaagaagcgggtgatccgcatgctcattgtcatcgtg
gtcctcttcttcctgtgctggatgcccatcttcagcgccaacgcctggcgggcctacgac
accgcctctgcggagcgccgcctttcagggacccccatttccttcatcctcctcctgtcc
tacacctcttcctgcgtcaaccccatcatctactgcttcatgaacaaacgcttccgcctc
ggcttcatggccaccttcccctgctgccccaatcctggtcccccaggggtgaggggagag
gtgggggaggaggaggaaggcaggaccacaggggcctctctgtccaggttctcctacagc
catatgagcgcctcggcgccaccccagtga

DBGET integrated database retrieval system