KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403660Help
Entry
100403660         CDS       T03264                                 

Gene name
CJA21
Definition
(RefSeq) olfactory receptor 7A10-like
  KO
K04257  olfactory receptor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    100403660 (CJA21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100403660 (CJA21)
G protein-coupled receptors [BR:cjc04030]
 Others
  Chemoreception
   Olfactory
    100403660 (CJA21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 100403660
NCBI-ProteinID: XP_008985674
LinkDB All DBs
Position
22
AA seq 347 aa AA seqDB search
MNILTAKYKWLPFSNASGALLSETQSCSLSLTSSHQNHVEPMNDTRILGFLLLGLSEEPE
LQPVIFGLFLSTYLMTVFGNLLIILAISSDSHLHTPMYFFLSNLSFVDICVTSTTLPKTL
SNIQTHSKVITYAGCVTQLYFFVLFIGLDSLLLTVMAYDRFVAICHPLHYTVIMNPQFCG
LLVLVSWIMSALHSLTESLMVLPLLFCTDLKIPQFFCEIHQIIHIACSDTFLNNLVMYLS
TVLLGGGPLAGILYSYSKIVSSIRAISSAEGKYKAFSTCASYLSVVSLFYCTGLGVYLSS
AATHSSLSSAAASVMYTVVTPMLNPFIYSLRNKDIKEALRRFFRRKK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcttgactgcaaaatataaatggttgcctttcagcaatgcgagtggtgccctt
ttgagtgaaactcagtcatgttctctttctctgactagtagtcaccaaaaccacgtggaa
cccatgaatgatacaaggattttaggatttcttcttctgggactttcagaggaaccagaa
ttgcagcctgttatctttggacttttcctctctacgtatctgatgactgtgtttggaaac
ctgctcatcatcctggccatcagctctgattcccacctccacacccccatgtacttcttt
ctctccaacctgtcctttgtggacatctgtgttacctccaccacacttccgaagacactg
tcaaacatccagacacacagcaaagtcatcacctatgcaggctgcgtcacccagttgtac
ttctttgtactcttcatagggttggacagcttactcctgaccgtgatggcctatgaccgg
tttgtggccatctgtcaccccctgcactacacggtcatcatgaaccctcagttctgtgga
ctgctggttctagtgtcctggatcatgagtgccctgcattccttgacagaaagcttaatg
gtattaccactgctcttttgtacagacttgaaaatcccccagtttttctgtgaaattcat
cagataattcatattgcctgttctgacacctttcttaataacctggtgatgtatttgtca
actgtgctcctgggcggtggtccccttgctgggatcctgtactcttactctaagatagtt
tcctctatacgtgcaatctcatcagctgaggggaagtacaaggcattttccacctgtgca
tcttacctctcagttgtctccttattctattgtacaggcctaggggtgtacctgagttct
gctgcaacccacagctcactctcaagcgcagcagcctcagtgatgtacactgtggtcacc
cccatgctgaaccccttcatctacagcctgaggaacaaagacataaaggaagctctaaga
cgattcttcagaagaaagaaataa

DBGET integrated database retrieval system