KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403702Help
Entry
100403702         CDS       T03264                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00020  Citrate cycle (TCA cycle)
cjc00190  Oxidative phosphorylation
cjc01100  Metabolic pathways
cjc01200  Carbon metabolism
cjc04714  Thermogenesis
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05010  Alzheimer's disease
cjc05012  Parkinson's disease
cjc05016  Huntington's disease
Module
cjc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cjc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cjc_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100403702 (SDHB)
  Energy metabolism
   00190 Oxidative phosphorylation
    100403702 (SDHB)
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    100403702 (SDHB)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100403702 (SDHB)
   05012 Parkinson's disease
    100403702 (SDHB)
   05016 Huntington's disease
    100403702 (SDHB)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100403702 (SDHB)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100403702 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_9
Motif
Other DBs
NCBI-GeneID: 100403702
NCBI-ProteinID: XP_002750378
Ensembl: ENSCJAG00000007927
UniProt: F7INC0
LinkDB All DBs
Position
7
AA seq 280 aa AA seqDB search
MAAVVALSLRRRFPATTVGGACLQACRGAQTAAAAAPRIKKFAIYRWDPDKAGDKPHMQT
YEVDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQGGKQQYLQSIEDREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcgccctctccttgaggcgccggttcccggccacaaccgttggcgga
gcctgcctgcaggcctgccgaggagcccagacagctgcagctgcagctccccgtatcaag
aaatttgccatctatcgatgggacccagacaaagctggtgacaaacctcatatgcagact
tatgaagttgaccttaataaatgtggccccatggtactggatgctttaatcaagattaag
aatgaaattgactctactttgaccttccggagatcatgcagagaaggcatctgtggctct
tgtgcaatgaacatcaatggaggcaacactctagcctgcacccgaaggattgacaccaac
ctcaataaagtctcaaaaatctaccctcttccacatatgtatgtgataaaggatcttgtt
cccgatttgagcaacttctatgcacagtacaaatccattgagccttatttgaagaagaag
gatgaatctcagggaggcaagcagcagtatctgcagtccatagaagaccgtgagaaactg
gacgggctctacgagtgcattctctgtgcctgctgtagcaccagctgccccagctactgg
tggaacggagacaaatatctggggcctgcagttcttatgcaggcctatcgctggatgatt
gactccagagacgacttcacagaggagcgcctggccaagctgcaggacccgttctctctg
taccgctgccacaccatcatgaactgcacaaggacctgtcccaagggtctgaatccaggg
aaggctattgcagaaatcaagaaaatgatggcaacctataaggagaagaaagcttcagct
taa

DBGET integrated database retrieval system