KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403708
Entry
100403708         CDS       T03264                                 

Gene name
HMGA2
Definition
(RefSeq) high mobility group AT-hook 2
  KO
K09283  high mobility group AT-hook protein 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc05202  Transcriptional misregulation in cancer
cjc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100403708 (HMGA2)
   05206 MicroRNAs in cancer
    100403708 (HMGA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100403708 (HMGA2)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100403708 (HMGA2)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Other transcription factors
   HMGI(Y)
    100403708 (HMGA2)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    100403708 (HMGA2)
SSDB
Motif
Pfam: AT_hook DUF5681
Other DBs
NCBI-GeneID: 100403708
NCBI-ProteinID: XP_002752759
Ensembl: ENSCJAG00000014566
LinkDB
Position
9
AA seq 109 aa
MSARGEGAGQPSTSAHGQPAAPVPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSP
SKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED
NT seq 330 nt   +upstreamnt  +downstreamnt
atgagcgcacgcggcgagggtgctgggcagccgtccacttcagcccatggacaacctgcc
gcccccgtgcctcagaagagaggacgcggccgccccaggaagcagcagcaagaaccaacc
ggtgagccctctcctaagagacccaggggaagacctaaaggcagcaaaaacaagagtccc
tctaaagcagctcaaaagaaagcagaagccactggagaaaaacggccacgaggcagacct
aggaaatggccacaacaagttgttcagaagaagcctgctcaggaggaaactgaagagaca
tcctcacaagagtctgccgaagaggactag

DBGET integrated database retrieval system