KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403873Help
Entry
100403873         CDS       T03264                                 

Gene name
TSC22D2
Definition
(RefSeq) TSC22 domain family member 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
SSDB OrthologParalogGFIT
Motif
Pfam: TSC22 YabA DivIC ZapB
Motif
Other DBs
NCBI-GeneID: 100403873
NCBI-ProteinID: XP_008981920
LinkDB All DBs
Position
17
AA seq 790 aa AA seqDB search
MSKMPAKKKSCFQITSVTTAQVATSITEDTESLDDPDESRTEDVSSEIFDVSRATDYGPE
EVCERSSSEETLNNVGDAETPGTVSPNLLLDGQLAAAGAAPANGGGVVSTRSVAGALAST
LAAAATSSPASVAPGGPQVAGSSAGPVTATPSQPPTTCSSRFRVIKLDHGSGEPYRRGRW
TCMEYYERDSDSSVLTRSGDCIRHSNTFDQTAERDSGLGATGGSVVVVVASMQGAHGPDS
GTDSSLTAVSQLPPSEKMSQPTLAQPQSFSVGQPQPPPPPPVGGAVAQSSAPLPPFPGAA
TGPQPMMAASQPSQLQGTVPGGQSLQPTNVTLTQPAMPLPTQPAMPLPPQPGPAVGTSAT
PQPQQFAYPQPQIPPGHLLPVQPSGQSEYLQQHVAGLQPPSPAQPSSTGAGASPATAASL
PVGTGQNASSVGTQLLGASSQPNEAVASRPGPTQGGQAAPCQPAGVAPAAVGGVVQAGMG
SAGAGQPQSVPPPQMGGSGPLSAVPGGPHAVVPGVPNVPAAVPAPSVPSVSTTSVTMPNV
PAPLAQSQQMSSHTSVSRSSSIIQHVGPPLAQGTHEQPTSLPQSDLSHQFQTQTQPLVGQ
VDDTRRKSEPLPQPPLSLIAENKPVVKPPVADALTNPLQLTPMNSLATSVFSIAIPVDGD
EDRNPSTAFYQAFHLNTFQESKSLWDSASGGGVVAIDNKIEQAMDLVKSHLMYAVREEVE
VLKEQIKELVERNSLLERENALLKSLSNNDQLSQLPTQQANPGSTSQQQAVIAQPPQPTQ
PPQQPNVSSA
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatgccggccaagaaaaagagctgcttccagatcaccagtgtcaccacggcc
caggtggccactagcatcaccgaggacaccgagagcttggacgacccggacgagtcacgc
acagaggacgtctcctccgagattttcgacgtctctcgggccacggattatggccctgag
gaggtctgcgagcgcagctcctccgaagagacacttaacaatgttggggatgcggagacc
cccgggaccgtctccccaaacctccttctggatgggcagctggcagcggcgggggctgct
cccgccaacggaggaggagtcgtttctacccggagcgtagctggggcgcttgccagtacc
ctggcggcggccgccacttcgtcccccgcctccgtagcacccggtggcccccaggtcgcg
ggctcatccgccggaccagtgactgcaaccccatctcagcctcccaccacttgtagttcc
cgttttcgtgtaatcaagctggaccacgggagcggagagccctatcgacgcggccgatgg
acgtgtatggaatactatgagagggattcagacagcagcgtcctgactagatccggggat
tgcattagacacagcaatacttttgaccagactgcagagcgggacagcggcctgggagcc
accggagggtcggtggtggtagtggtggcttccatgcagggggcgcacgggcccgactcg
ggaactgacagctccttgactgctgtgtcacagctacccccgtcggagaaaatgagccag
cccactctggcccagccgcagagttttagcgttgggcagccacagccgccgccgccgccg
cccgtaggtggggctgtggctcagagctcggctccgctgccgccgttcccgggagccgcg
accgggccacagccgatgatggcagcctcgcagccaagccagctccagggaacggtgccc
ggaggacagagtttgcagccgacgaatgtaaccctgacgcagccggctatgcccctgcct
acgcagccggctatgccccttcctccgcagccgggcccggctgtcggcacttctgcgacg
ccgcagccccagcaattcgcgtatcctcagcctcagataccgcccggacatttgctgccc
gtccagccctccggccagagtgagtacctacagcagcacgtggccggcctgcaacctcca
agccccgcgcagccctcgtccaccggcgccggagcgagcccagccacggcagccagcctt
cccgtgggcaccggccagaacgcctcttcggtgggcacgcagctcctgggcgcgtcttcc
cagcccaacgaagcggtggcctcccggccgggaccaacgcagggcggacaggccgcgccg
tgtcagccggctggagtggccccggctgctgtgggaggcgtggtgcaggcgggcatgggt
tctgccggggctgggcagccccagtccgtgcctccgccgcagatgggtggcagtggtccg
ctgtcagccgtacctggtggccctcacgccgtggtgcccggagttccaaacgtgcctgca
gcggtgcccgctccaagcgtgcctagtgtgtctaccacttctgttactatgccaaatgta
cccgcgcctctggcccagtcgcaacagatgagcagccatacttcagtcagcaggagcagc
agcataatccagcacgttgggccgcccttagcgcaaggaacacacgaacagccaacaagt
ctaccacagtctgacctaagccaccagtttcagactcagacccagcctttagtcgggcaa
gtcgacgatactagaagaaaatcagaacccctacctcaaccaccactttctctcattgct
gaaaataagcctgttgtgaagccgcctgttgcagatgccctgacaaacccccttcagtta
acacctatgaacagtctggccacctctgtattcagcatagctattcctgttgatggtgat
gaagacaggaatccttcaactgctttctaccaagcgttccatttgaacacgtttcaggaa
tcaaagagcctctgggatagtgcatctgggggaggtgttgtagccattgacaacaaaata
gaacaagcaatggatctggtgaaaagccatttgatgtatgcagtaagagaagaagtggaa
gttttaaaggaacaaataaaagaattagttgaaagaaactctttacttgaacgagaaaat
gcactgttaaaatctctttcaaacaatgatcaattatcccaactcccaacccaacaggcc
aatcctggtagcacttctcaacagcaagcagtgatagcacagcctccgcagccaacgcaa
cctccacagcagccgaatgtctcctcagcataa

DBGET integrated database retrieval system