KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403981
Entry
100403981         CDS       T03264                                 

Gene name
TMEM173
Definition
(RefSeq) transmembrane protein 173
  KO
K12654  transmembrane protein 173
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc05163  Human cytomegalovirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100403981 (TMEM173)
   04622 RIG-I-like receptor signaling pathway
    100403981 (TMEM173)
   04623 Cytosolic DNA-sensing pathway
    100403981 (TMEM173)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100403981 (TMEM173)
   05171 Coronavirus disease - COVID-19
    100403981 (TMEM173)
   05168 Herpes simplex virus 1 infection
    100403981 (TMEM173)
   05163 Human cytomegalovirus infection
    100403981 (TMEM173)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100403981 (TMEM173)
Membrane trafficking [BR:cjc04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    100403981 (TMEM173)
SSDB
Motif
Pfam: TMEM173
Other DBs
NCBI-GeneID: 100403981
NCBI-ProteinID: XP_002744307
Ensembl: ENSCJAG00000016886
UniProt: F7HWC7
LinkDB
Position
2
AA seq 377 aa
MPHSSLHPSIPHPRGHGAQEAALVLLSVCLVTLWWLREAPEDILRFLVLHLASLQLGLLL
NRLCSLAEELRHVHTRYQGSYWRAVRACLGCPIRLGAQLLLSIYFYCFLPNGRPFTWMLA
LLGFSQALNILLGLKGLAPAEISAVCEKRNFNVAHGLAWSYYIGYLRLILPGFQARIRTY
NQHNNNVLRGPASQRLYILFPLDCGVPDNLSTADPNIRFLDKLPQETIDRAGIKGRVYTN
SIYELLENGQRAGACVLEYASPLQTLFAMSQYGQAGFSREDRLEQAKLFCRTLEDILADA
PESQNNCRLIVYEEPADGSSFLLSQEVLQHLRQEEEEEVTVGSLKTSEVPSTSTMSQEPE
LLISGMEKPLPLRSDLF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgccccactccagcctacatccatccatcccacatccccggggtcacggggcccaggag
gcagccttggttctgctgagtgtctgtctggtgactctttggtggctacgagaggcacca
gaggacattctccggtttctagtcctccacctagcctccctgcagctgggactgctgttg
aacaggctctgcagcctggctgaggagctgcgccacgtccacaccaggtaccagggcagc
tactggagggctgtgcgagcctgcctaggctgccccatccgccttggggcccagttgttg
ctgtccatctatttctactgcttcctcccaaatggccggcccttcacttggatgcttgcc
ctcctgggcttctcgcaggcactgaacatcctcctgggcctcaagggcctggccccagct
gagatctctgcagtctgtgaaaaacggaacttcaatgtggcccatgggctggcatggtca
tattacatcgggtacctgcggctgatcctgccaggattccaggcccggattcgaacttac
aatcagcataacaacaatgtgctacggggtccagcgagccagcggctgtatatcctcttc
ccattggactgtggggtgcctgacaacctgagtacagctgaccccaacattcgcttcctg
gataaactgccccaggagaccattgaccgtgctggcatcaaggggcgggtttacaccaac
agcatctatgagcttctggagaacgggcagcgagcaggagcctgtgtcctggagtacgcc
tccccgctgcagactttgtttgccatgtcacaatatggccaagctggctttagccgggag
gatcggcttgagcaggccaaactcttctgccggacacttgaggacatcctggcagatgcc
cctgagtctcagaacaactgccgcctcattgtctatgaggaacctgcagatggaagcagc
ttcttgctgtcccaggaggttctccagcatctgcggcaggaggaagaggaggaggttact
gtgggcagcttgaagacctcagaggtgcccagtacctccacgatgtcccaagagcctgag
ctcctcatcagtggaatggaaaagcccctccctctccgctcggatctcttctga

DBGET integrated database retrieval system