KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404104Help
Entry
100404104         CDS       T03264                                 

Gene name
PTPN23
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 23
  KO
K18040  tyrosine-protein phosphatase non-receptor type 23 [EC:3.1.3.48]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100404104 (PTPN23)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100404104 (PTPN23)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    100404104 (PTPN23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BRO1 Y_phosphatase ALIX_LYPXL_bnd Y_phosphatase3 DSPc SOGA PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 100404104
NCBI-ProteinID: XP_008979823
Ensembl: ENSCJAG00000002397
LinkDB All DBs
Position
15
AA seq 1634 aa AA seqDB search
MPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELLRQNAVRVPRDFEGCS
VLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYNLGALHS
MLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILSLNVNLMLGQAQ
DCLLEKSMLDNRKSFLVARISAQVVDYYKEACRALXNPDTASLLAGSEGLEELVQMKIYY
FAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRFTMDVIGG
KYNSAKKDNDFIYHDAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKLVPMAAHE
ASSLYSEEKAKLLREMMAKIEDKNEVLDQFMDSMQLDPETVDNLDAYSHIPPQLMEKCAA
LSVRPDTVKNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELLEQKFQEAVGQAGAISAAI
SAVSKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVSNLRLLSGPLDQVRAALPTP
ALTPEDKAVLQNLKRILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDHSEMKKLFE
EQLKKYDQLKVYLEQNLAAQDRILRALTEANVQYAAVRRVLSDLDQKWNSTLQTLVASYE
AYEDLMKKSQEGRDFYADLESKVAALLECTQSTCQAREAARQQLLDRELKKKPPPRPTAP
KPLLPRREESEAVEAGDPPEELRSLPPDMVAAPRPPDAFLGTATPLHFPPSPFPSSTGPG
PHYLSGPMPPGTYSGPTQLMQPRAPGPSAMPVAPGPALYPAPAYTPELGLVPRSSPQHGV
VSSPYRGVGPAPPVAGLPSAPPQFSGPELAMGVRPATTTVDSIQAPISSHMAPRPNPTPT
PPQPCFPVPPPQPLPTPYTYPVGAKQPIPAQHHFSPGIPTGFPAPRIGPRPQPQPQPQPH
PSQAFGPQPPQQPLPLQHPHLFPPQAPGLLPPQPPYTYAPQPGVLGQPPPPLHTQLYPGP
AQDTLPPHSGALPFPSPGPPRPPHPPLAYGPAPSARPMGPQAAPLTIRGPLPAGQPTPSP
HLVPSPAPSPGPGPVPPRPPAAEPPPCLXRGATAADLLSSSPESQHGSTQPPGGGQPLLQ
PTKVDAAEGRKPQALRLIEQDPYEHPERLRQLQQELEAFRGQLGDMGALDTIWRELQDAQ
EHDARGRSIAIARCYSLKNRHQDVMPYDSNRVVLRSGKDDYINASCVEGLSPYCPPLVAT
QAPLPGTAADFWLMVHEQKVSVIVMLVSEAEMEKQKVARYFPTERGQPMVHGALSLALSS
VRSTETHVERVLSLQFRDQSLKRSLVHLHFPTWPELGLPDSPSNLLRFIQEVHAHYLHQR
PLHTPIVVHCSSGVGRTGAFALLYAAVQEVEAGNGIPELPQLVRRMRQQRKHMLQEKLHL
RFCYEAVARHVEQVLQRHGVPPPCKPLASASISQKNHLPQDSQDLVLGGDVPISSIQATI
AKLSIRPPGGLESLAASLPGPAEPPGLLPASLPESTPIPSSSPPPLSSPLPEAPQPEEEP
PVPEAPSSGPPSSSLELLASLTPEAFSLDSSLRGKQRMSKQNFLQAHNGQGLRATRPSDD
PLSLLDPLWTLNKT
NT seq 4905 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgatctggctggacctgaaggaggctggtgacttccacttccagccagctgtg
aagaagtttgtcctgaagaattacggagagaacccagaagcctacaatgaagaactgaag
aagctggagttgctcagacagaatgctgtccgggtcccacgggactttgagggctgtagt
gtcctccgcaagtacctcggccagcttcactacctgcagagtcgggtccccatgggctcg
ggccaggaggctgctgtccctgtcacctggacagagatcttctcaggcaagtctgtggcc
catgaggacatcaagtacgagcaggcctgtattctctacaaccttggagcgctgcactcc
atgctgggggccatggacaagcgggtgtccgaggagggcatgaaggtctcctgtacccac
ttccagtgcgcagctggcgcctttgcctacctgcgggagcacttccctcaagcctacagt
gtcgacatgagtcgccagatccttagtctcaacgtcaacctcatgctgggccaggctcag
gattgcctcctggagaagtcaatgttggacaacagaaagagctttctggtagcccgcatc
agtgcacaggtggtagattactataaggaggcatgccgggccttanagaaccctgacacc
gcctcactgctggccggatcagaaggactggaagagctcgtgcaaatgaagatctactac
tttgcagctgtggctcatctgcacatgggaaagcaggctgaggagcagcagaagttcggg
gagcgggttgcgtacttccagagtgccctggacaagctcaatgaagccatcaagttggcc
aagggccagcctgacactgtgcaagatgcgcttcgcttcactatggatgtcattggggga
aagtacaattcagccaagaaggacaatgacttcatctaccacgacgctgtcccagcattg
gacactcttcagcctgtaaaaggagcccccttggtgaagcccttgccagtgaaccccaca
gatccagctgttacgggccctgacatctttgccaaactggtacccatggctgcccatgag
gcctcgtcactgtacagcgaggagaaggccaagctgcttcgggagatgatggccaagatt
gaggacaagaatgaggtcctggaccagttcatggactcaatgcagttggatcccgagacc
gtggacaaccttgatgcctacagtcacatcccaccccagctcatggagaagtgtgcggcc
ctcagtgtccggccggacactgtcaagaacctcgtccaatccatgcaagtgctgtcgggc
gtgtttacggatgtggaagcctccctgaaggacatcagagacctgctggaggaggatgaa
ctgctagagcagaagttccaggaggcagtgggccaggctggggccatctccgccgccatc
tctgcagtctccaaggctgaattggccgaggtgaggcgagaatgggccaagtacatggaa
gtccacgagaaggcctccttcaccaacagtgagctgcaccgtgccatgaacctgcacgtc
agcaacctgcgcctcctcagcgggccactggaccaggtccgggctgccctgcccacaccg
gccctcaccccagaggacaaggccgtgctgcagaacctaaagcgcatcctggccaaggtg
caggagatgcgggaccagcgtgtgtccctggagcagcagctgcgtgagcttatccagaag
gatgacatcactgcctcgctggtcaccacagaccactcagagatgaagaagctatttgag
gagcagctgaagaagtacgatcagctgaaggtgtacctggagcagaacttggcagcccag
gaccgcatcctccgcgcgctaacagaagccaatgtgcagtacgcggccgtgcggcgggtg
ctcagtgacctggaccaaaagtggaactccacgttgcagaccttggtggcctcatatgaa
gcctatgaggacctgatgaagaagtctcaggagggcagggacttctatgcagacctggag
agcaaggtggccgctctgctggagtgcacgcagtccacctgccaggcccgagaagctgcc
cgccagcagctcctggacagggagctgaagaagaagccgccgccacggcccacggcccca
aagccgctgctgccccgcagggaggagagtgaggcagtggaggcaggagaccccccggag
gagctacgcagtctgccccctgacatggtggctgctccacgaccgcccgacgccttcctg
ggaactgccaccccactccactttcctcccagccccttccccagctccacaggtccagga
ccccactacctctcaggcccgatgccccctggtacctactcaggccccacacagctgatg
cagcccagggccccagggccctctgcaatgcccgtggcacctgggcctgccctctaccca
gcccctgcctacaccccagagctgggccttgtgccccgatcctccccgcagcatggtgtg
gtgagcagtccctatcggggggtaggaccagccccaccagttgcaggtctgccctcggct
ccacctcaattctccggccctgagttggccatgggggttcggccagccaccaccacagta
gacagcatccaggcccctatctccagccacatggccccacggccaaaccccacccctact
cctccccagccctgcttcccagtgcccccaccacagccactgcccacgccttacacctac
ccagtaggagccaagcaacccatcccagcccagcaccacttctctcctgggatccccaca
ggttttccagccccgaggattgggccccggccccagccccagccccagccccagccccat
ccttcccaagcctttgggcctcagcccccacagcagccccttccacttcagcatccgcac
ctcttcccaccccaggccccaggactcctacctccacaacccccttacacctatgcccct
caacctggggtcctggggcagccgccaccccccctgcacacccagctctacccaggtcct
gctcaagatactctgccaccccactcgggggctctgcctttccctagccctgggccccct
cggcctccccatcccccactggcctatggtcctgccccttctgccagacccatgggcccc
caggcagcccctcttaccatccgaggcccccttcctgctggccagcccacccctagtccc
cacctggtgccttcacctgccccatctccagggcctggcccagtaccccctcggccccca
gcagcagaaccacccccttgcctgncgcgaggcgctacagctgcagacctgctctcctcc
agcccagagagccagcatggcagcactcagcctcctgggggtgggcagcccctgctgcag
cctaccaaggtggatgcagctgagggccgtaagccgcaggccctgcggttaatcgagcaa
gacccctacgagcatcctgagaggctgcggcagttgcagcaggagctagaggcctttcgg
ggccagctgggggacatgggggctctggacaccatctggcgggagctacaagatgcacag
gaacacgatgcccgaggccgttccatcgccatcgcccgctgctactcactgaagaaccgg
caccaggatgtcatgccctatgacagtaaccgtgtggtgctgcgctcaggcaaggatgat
tacatcaatgccagctgcgtggaggggctctcgccgtactgcccccccttagtggccacc
caggccccactgcctggcacagctgctgacttctggctcatggtacatgagcagaaagtg
tcagtcattgtcatgctggtttctgaggctgagatggagaagcaaaaagtggcacgctac
ttccccaccgagaggggccagcccatggtacatggtgctttgagcctggcactgagcagc
gtccgcagcactgaaacccatgtggagcgtgtgctgagcctacagttccgagaccagagc
ctgaagcgctctcttgtgcacctccacttccccacttggcctgagttaggcctgcctgac
agccccagcaacttgctgcgcttcatccaggaggtgcacgcacattacctgcatcagcgg
ccgttgcacacgcccatcgtcgtgcactgcagctctggtgtgggccgcacgggagccttc
gcgctgctctatgcagccgtgcaggaggtggaggctgggaacgggatccccgagctgcct
cagctggtgcggcgcatgcggcagcagaggaagcacatgctgcaggagaagctgcacctc
aggttctgctatgaggcagtggcgagacatgtggagcaggtcctgcagcgccacggtgtg
ccccctccatgcaaacccttggccagcgcaagcatcagccagaagaaccaccttcctcag
gactcccaggacctggtccttggtggggacgtgcccatcagctccatccaggccaccatt
gccaagctgagcatccggcctcctggggggttggagtccctggctgccagcttgccaggc
ccggcagagcccccaggcctgctgccagccagcctcccggagtctaccccaatcccatct
tcctccccacccccgctttcctcccccctgcctgaggctccccagcctgaggaggagccg
ccagtgcctgaagcccccagctcagggcccccctcctcctccctggagctgctggcctcc
ttgaccccagaggccttctccctggacagctccctgcgaggcaagcagcggatgagcaag
cagaactttctgcaggcccataacgggcaggggcttcgggccacccggccctctgatgac
cccctcagccttctggatccactgtggacactcaacaagacctga

DBGET integrated database retrieval system