KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404210
Entry
100404210         CDS       T03264                                 

Gene name
PTK2B
Definition
(RefSeq) protein tyrosine kinase 2 beta
  KO
K05871  focal adhesion kinase 2 [EC:2.7.10.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04020  Calcium signaling pathway
cjc04062  Chemokine signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04670  Leukocyte transendothelial migration
cjc04912  GnRH signaling pathway
cjc05135  Yersinia infection
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100404210 (PTK2B)
   04072 Phospholipase D signaling pathway
    100404210 (PTK2B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100404210 (PTK2B)
   04670 Leukocyte transendothelial migration
    100404210 (PTK2B)
   04062 Chemokine signaling pathway
    100404210 (PTK2B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100404210 (PTK2B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100404210 (PTK2B)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100404210 (PTK2B)
   05161 Hepatitis B
    100404210 (PTK2B)
   05163 Human cytomegalovirus infection
    100404210 (PTK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100404210 (PTK2B)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100404210 (PTK2B)
Protein kinases [BR:cjc01001]
 Non-receptor tyrosine kinases
  FAK family
   100404210 (PTK2B)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT FERM_N_2 Pkinase FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 100404210
NCBI-ProteinID: XP_003734619
Ensembl: ENSCJAG00000019574
LinkDB
Position
13
AA seq 1009 aa
MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIKSIRCLPLEDSQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQG
SLIVHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRTGGPQYGI
VREDVVLNCILGEGFFGEVYEGVYTNHKGENINVAVKTCKKDCTLDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNRNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPILYTLMTR
CWDYDPSDRPRFTELVCSLSDIYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIRPSSREEAQQLWEAEKIKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
LTPEKEVGYMEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMALVRAVLDLKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
NT seq 3030 nt   +upstreamnt  +downstreamnt
atgtctggggtgtccgagcccctgagtcgagtaaagttgggcacgttacgccggcccgaa
ggccccgcagagcccatggtggtggtaccagtagatgtggaaaaggaagacgtgcgtatc
ctcaaggtctgcttctatagcaacagcttcaatcccgggaagaatttcaaactggtcaaa
tgcactgtccagacagagatccgggagatcatcacctccatcctgctgagtgggcggatt
gggcccaacatccagctggctgagtgctatgggctgaggctgaagcacatgaagtcagat
gagatccactggctgcacccgcagatgacggtgggtgaggtgcaggacaagtatgagtgc
ctgcacgtggaagccgagtggaggtatgaccttcaaattcgctacttgccggaagacttc
atggagagcctgaaggaggacaggaccacactgctctatttttaccaacagctccggaac
gactacatgcaacgctatgccagcaaggtcagtgaaggcatggccttgcagctgggctgc
ctggagctcaggcgattcttcaaggatatgccccacaatgcccttgacaagaagtccaat
tttgagctcctagaaaaggaagtggggctggacttgtttttcccaaagcagatgcaggag
aacttaaagcccaaacagttccggaagatgatccagcagaccttccagcagtatgcctcg
ctccgggaggaggagtgcgtcatgaagttcttcaacaccctcgctggcttcgccaacatt
gaccaggagacctaccgctgtgaactcattcaaggatggaacattactgtggacctggtc
attggccctaaaggcatccgccagctgactagccaggatgcaaagcccacctgcctggcc
gagttcaagcagattaagtctatcaggtgcctcccgctggaagacagccaggcagtgctg
cagctgggcattgaaggtgccccccaggccttgtccatcaaaacctcatccctggcagag
gctgagaacatggctgacctcatagatggctactgccggctgcagggggagcaccaaggc
tctctcatcgtccaccctaggaaagatggcgagaagcggaacagcctgccccagatcccc
atgttaaacctggaagcccgccggtcccacctctccgagagctgcagcatagagtcagac
atctatgcagagattcccgacgaaaccctgcgaaggactggaggtccacagtatggcatt
gtccgtgaagatgtcgtcctgaattgtattcttggggaaggcttttttggggaggtctat
gaaggtgtctacacgaatcacaaaggggagaatatcaacgtagctgtcaagacctgcaag
aaagactgcactctggacaacaaggagaagtttatgagtgaggcagtgatcatgaagaac
ctggaccacccacacattgtgaagctgattggcatcattgaagaggagcccacctggatc
atcatggaattgtatccctatggggagctgggccactacctggagcggaacaggaactcc
ctgaaggtgctcacccttgtgctgtactcgctgcagatatgcaaagccatggcctacctg
gagagcatcaactgtgtgcacagggacattgctgtccggaacatcctggtggcctccccc
gagtgcgtgaagctgggggacttcggcctttcccggtacattgaggatgaggactattac
aaagcctctgtgactcgcctccccatcaaatggatgtccccagagtccattaacttccga
cgcttcactacagccagtgacgtctggatgtttgctgtgtgcatgtgggagatcctgagc
tttgggaagcagcccttcttctggctggagaacaaggacgtcatcggagtgctggagaaa
ggggacaggctgcccaagcccgacctctgtccaccgatcctttataccctcatgacccgc
tgctgggactatgaccccagcgaccggccccgattcaccgagctggtgtgcagccttagt
gacatttatcagatggagaaggacattgcaatggagcaagagaggaatgctcgctaccga
acccccaaaatcttggagcccacagccttccaggaacccccacccaagcccagccggcct
aagtacaggccccctccacaaaccaacctcctggctccaaagctgcagttccaggtcccc
gagggtctgtgtgccagctctcctacgctcaccagccctatggagtatccatctcctgtt
aactcactgcacaccccacctctccaccggcacaatgtcttcaaacgccacagcatgcgg
gaggaggacttcatccgacccagcagccgagaagaggcccagcagctgtgggaggccgag
aagatcaagatgcggcaaatcctggacaagcagcagaagcagatggtggaggactaccag
tggctcaggcaggaggagaagtccctggaccccatggtttatatgaatgataagtcccca
ttgactccagagaaggaggtcggctacatggagttcacggggcccccgcagaagcctcca
aggctgggcgcacagtccatccagcccacagccaacctggaccggactgatgacctggtg
tacctcaatgtcatggcgctggtgcgggccgttttggacctcaagaatgagctctgtcag
ctgccccccgagggctatgtggtggtggtgaagaacgtggggctgaccctgcggaagctc
atcgggagcgtggacgatctcctgccctccttgccgtcatcttcacggacagagatcgag
ggtacccagaaactgctcaacaaagacctggcggagcttatcaacaagatgaggctggca
cagcagaatgccgtgacctccctgagtgaggagtgcaagaggcagatgctgacagcctca
cacaccctggccgtggacgccaagaacctgctcgatgccgttgaccaggccaaggttctg
gccaatctggcccacccgcctgcagagtga

DBGET integrated database retrieval system