KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405036
Entry
100405036         CDS       T03264                                 

Gene name
IRF7
Definition
(RefSeq) interferon regulatory factor 7
  KO
K09447  interferon regulatory factor 7
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05164  Influenza A
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05203  Viral carcinogenesis
cjc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100405036 (IRF7)
   04621 NOD-like receptor signaling pathway
    100405036 (IRF7)
   04622 RIG-I-like receptor signaling pathway
    100405036 (IRF7)
   04623 Cytosolic DNA-sensing pathway
    100405036 (IRF7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100405036 (IRF7)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100405036 (IRF7)
   05160 Hepatitis C
    100405036 (IRF7)
   05164 Influenza A
    100405036 (IRF7)
   05162 Measles
    100405036 (IRF7)
   05168 Herpes simplex virus 1 infection
    100405036 (IRF7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100405036 (IRF7)
   05169 Epstein-Barr virus infection
    100405036 (IRF7)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100405036 (IRF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100405036 (IRF7)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    100405036 (IRF7)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 100405036
NCBI-ProteinID: XP_002755734
Ensembl: ENSCJAG00000012124
UniProt: U3BP84
LinkDB
Position
11
AA seq 502 aa
MALASQRAAPRVLFGEWLLGEVSSGRYEGLRWLDEARTRFRVPWKHFGRKDLSEADARIF
KAWAVARGRWPPSSSGGDQPPCEAAERAGWKTNFRCALHSTRRFVMLRDNSGDPADPHKV
YTLSQELGCREGPGTDRTEAEAPMADPPSQAGPPGPFLAQGDAEVQVPSLLPAPAGDQQD
LLLQAMWQSCLGDNLLTASWGADPGPAKAPGEGLNALSPTGGYARDSGLPAGELYKWAAE
GTPSPRTQPPALMAGEATAPEPLHQAEPYLARSPGACTVVGEPGPGVLDVTITYKGRTVL
QQVVERPSCVFLYGPQGPAIWATDPQPVAFPSPAELPDQKQLRYTEELLRHVAPGLQLEL
RGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRARR
RCNSPHCTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVYLEGTQREGVSSLDSSSLSLC
LSSANSLYDVIEGFLMELEQPA
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggccttggcttcgcagagggcagccccacgcgtgctgttcggagagtggctccttggg
gaggtcagcagcggccgctacgaggggctgcggtggctggacgaggcacgcacccgcttc
cgcgtgccctggaagcacttcgggcgcaaggacctgagcgaggcggacgcgcgcatcttc
aaggcctgggccgtggctcgcggcaggtggccgcccagcagcagcggaggtgaccagccg
ccctgcgaggctgcggagcgcgccggctggaaaaccaacttccgctgcgccctgcacagc
acgcgtcgcttcgtgatgctacgggacaactcgggggaccctgcggacccccacaaggtg
tacacgctcagccaggagctgggctgccgagaaggcccaggcacggaccggacagaggca
gaggcccccatggctgacccaccctcccaggctgggcccccagggccattcctagcacaa
ggagatgctgaagtccaagtcccaagcctcctccctgccccagccggggaccagcaggac
ctcctgcttcaggcgatgtggcagagctgcctgggggacaatctgctgacagcatcatgg
ggggcagatccaggcccagccaaggctcctggagagggactgaacgcgctttccccgact
gggggctatgctagagactcagggctccctgctggggagctgtacaaatgggcagcagag
gggaccccaagccccaggacccagcccccggccctaatggcaggcgaggccacagcccca
gagcccctgcaccaggcagagccatacctggcccgctccccaggtgcctgcactgtggtg
ggagagcccggcccaggggtgctggacgtgaccatcacctacaagggccgcacggtcctg
cagcaggtagtggagcgcccgagctgtgtgttcctgtatggcccccagggcccagccatc
tgggccacagaccctcagccggtggcattccccagccctgctgagcttccggaccagaag
cagctgcgctacacggaagagctgctgcggcatgtggcccccgggctgcagctggagctt
cgggggccgcagctgtgggctcggcgcatgggcaagtgcaaggtatactgggaggttggc
ggccccccaggctccgccagcccctccaccccagcctgcctgctgcctcgcaactgtgac
acccccatcttcgacttcagagtcttcttccaagagctggtggaatttagggcacggcgc
cgctgcaactccccacactgcaccatctacctgggcttcggccaggacttgtcagccggg
agacccaaggagaagagcctggtcctggtgaagctggagccctggctgtgccgagtgtac
ctggagggcacgcagcgcgagggggtgtcgtccctggacagcagcagcctgagcctctgc
ctgtccagcgccaacagcctctacgatgtcatcgagggcttccttatggagctggagcag
cctgcctag

DBGET integrated database retrieval system