KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405137Help
Entry
100405137         CDS       T03264                                 

Definition
(RefSeq) leucine-rich repeat-containing protein 37B-like
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
SSDB OrthologParalogGFIT
Motif
Pfam: LRRC37
Motif
Other DBs
NCBI-GeneID: 100405137
NCBI-ProteinID: XP_008989084
LinkDB All DBs
Position
Un
AA seq 523 aa AA seqDB search
MVPAQCTEPALLMSGLSLWALWPFLTWLIVQEAQPLEWVKDPLQLTSNPLGPTEPWSSRS
SNLPWESLHGLSSPADPGGFDYLGSSASSQRSAPPKELTDNLVEFLDPESAGELPPGPEH
FSSAHPDLNDRLTRQERLPKDILYPGSLPPELQVNLDEPPGPPMEPELSPSEQEQPTQPS
ESSGELEPSQTQEDTLAQPPEEMEPSAIQEETPTEPPGPPMETELSPSEQKQPAQPSESS
GELESSPAQQEATVQALEPPKEVEPSSQQMVPAQLPEPSKEVAAQPPAHYEVTFPTPGQD
QAQHSMSSSVTVQPLDLGLTLSPEPSTEVEHSTPLKKTIVPSKHPKVTLPHPDRVQTQHS
NLTQTTVQPLDLGLTITPESTTEVESSTALTTTAPPPKQPEVTLPPSDKGQSQHQNLTEV
THPPTELEPTQDSLVQPETYTQNRALTVRKEQASTSTNICDLCTCRDETLSCIALSPKQR
LRHVPVPEPNTYNGTFTILNLQGNYISYIDGKVWKAYHWTEKL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggttcctgctcaatgcacagaaccagcgcttctcatgtctgggctaagtctctgggcc
ctatggcccttcctcacgtggctaatagtccaggaggctcagcctctggagtgggtcaag
gacccgctccagctgacctctaaccccctggggcccactgagccctggtcttcccgctcc
tccaatctcccatgggaatctctccatgggcttagttccccggcagacccggggggcttt
gattacctggggtcctctgcttcctcccagaggtcagccccgcccaaggaattgactgat
aatttggttgaatttctggacccagagtcagctggagagctgccccccgggcccgagcac
ttctcgtctgcacacccggatctgaatgacaggctgactcggcaagaaaggctcccaaag
gatattctgtatcccggcagcctgcctccagaactccaggtgaacttggatgagcctcca
ggtcctcctatggagcctgaactttcccccagtgagcaggagcagccaactcagccttct
gaatcttctggggagcttgaaccttctcagacccaggaggacaccctagctcagcctcca
gaagagatggaaccttctgcaatccaagaggagaccccaactgagcctccaggtcctcct
atggagactgaactttcccccagtgagcagaagcagccagctcagccttctgagtcttct
ggagagcttgaatcttctccagcccagcaggaagccacagttcaggctctagagccccct
aaggaggtagaaccttcaagccagcagatggtcccagctcagctcccagagccatctaag
gaggttgcagctcaacctccagctcattatgaggtgacatttccaacaccaggtcaggat
caagctcagcattcaatgtcatccagcgttacagttcaaccactggatctgggacttacc
ctatctccagaacccagtacagaggttgaacattctacacccctgaagaagactatagtt
ccttcaaagcaccctaaggtgacacttccacatccagaccgtgttcagactcagcattca
aacctgactcaaaccacagttcaacctttggatctggggcttaccatcactcctgaatcc
actacagaggttgaatcttccacagccctgacgactacagctcctcctccaaaacagcct
gaggtgacacttccaccttcagacaagggtcagagtcagcatcaaaacctgactgaagtc
acacatccacctactgaactagaacctactcaggattcactggtgcagcctgaaacttac
acccaaaatagggctttaactgtacggaaagaacaggcctccacaagcaccaacatatgt
gacctctgtacctgcagagatgagacgctgtcgtgtattgctctcagcccgaagcagagg
ctccgccatgtgcctgtgccagagccgaacacctacaatggcaccttcactatcttaaat
ttacaaggaaactatatttcttatattgatggaaaggtatggaaggcataccattggacc
gagaaactgtga

DBGET integrated database retrieval system