KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405157Help
Entry
100405157         CDS       T03264                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00512  Mucin type O-glycan biosynthesis
cjc01100  Metabolic pathways
Module
cjc_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100405157 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cjc01003]
    100405157 (GALNT9)
Enzymes [BR:cjc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100405157 (GALNT9)
Glycosyltransferases [BR:cjc01003]
 O-Glycan biosynthesis
  Mucin-type
   100405157 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 100405157
NCBI-ProteinID: XP_009003175
LinkDB All DBs
Position
9
AA seq 460 aa AA seqDB search
MTYARDLPQVSVVFIFVNEALSVILRSVHSVVNHTPSQLLKEVILVDDNSDNVELKFNLD
QYVNKRYPGLVKIVRNSRREGLIRARLQGWKAATAPVVGFFDAHVEFNTGWAEPALSRIR
EDRRRIVLPAIDNIKYSTFEVQQYANAAHGYNWGLWCMYIIPPQDWLDRGDESAPIRTPA
MIGCSFVVDREYFGDIGLLDPGMEVYGGENVELGMRVWQCGGSMEVLPCSRVAHIERTRK
PYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIPMTNPGVDFGDVSERLALRQKLKCR
SFKWYLENVYPEMRIYNNTLTYGEVRNSKASGYCLDQGAEDDDRAILYPCHGMSSQLVRY
SADGLLQLGPLGSTAFLPDSKCLVDDGRGRTPTLKKCEDVARPAQRLWDFTQSGPIVSRA
TGRCLEVEMAKDANFGLRLVVQRCSGQKWMIRNWIKHTRH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgacctacgcccgggacctgccccaggtctccgtggtcttcatcttcgtcaacgaggcg
ctgtccgtcatcctgcgctccgtgcacagtgtggtcaaccacacgccctcgcagctgctc
aaagaggtcatcctggtggatgacaacagtgacaatgtggagctcaagttcaatctggac
cagtacgtcaacaagcgctacccgggcctggtgaagatcgtccgaaacagccggagggaa
gggctgatccgtgcccggctgcagggctggaaggcagccaccgcaccggtcgtcggcttc
ttcgatgcccacgttgagttcaacacaggctgggcggagcccgcgctgtcgcgcatccgg
gaggaccggcgtcgcatcgtgctgccggccatcgacaacatcaagtacagcacgttcgag
gtgcagcagtacgccaacgccgcccacggctacaactggggcctctggtgcatgtacatc
atccccccgcaggactggctggatcgcggcgacgagtcggcgcccatcaggaccccggcc
atgatcggctgctcctttgtggtagaccgtgaatacttcggggacattgggctgctggac
cccggcatggaggtgtacggcggtgagaacgtggagctgggcatgagggtgtggcagtgt
ggcggcagcatggaggtcctgccctgctcgcgcgtggctcacatcgagcgcaccaggaag
ccctacaacaatgacatcgactactacgccaagcgcaacgccctgcgcgccgccgaggtg
tggatggacgacttcaagtcccacgtgtacatggcctggaacatccccatgacgaacccc
ggggtggacttcggggacgtgtccgagaggctggccctgcgccagaagctgaagtgtcgc
agcttcaagtggtacctggagaacgtgtacccggagatgaggatctacaacaacacgctc
acgtacggagaggtgagaaacagcaaagccagcggctactgcctggaccagggagcggag
gacgatgaccgagcgatcctctacccctgccacgggatgtcctcccagctggtgcggtac
agcgcggacggcctgttgcagctggggcctctgggctccacggccttcctgcctgactct
aagtgtctggtggatgacggcaggggccgcacgcccaccctgaagaagtgtgaggatgtg
gcacggccagcacagcggctgtgggacttcacccagagcggccccatcgtgagccgggcc
acaggccgctgcctggaggtggagatggccaaagacgccaacttcgggctccggctggtg
gtgcagaggtgctcggggcagaagtggatgatcagaaactggatcaaacacacgcggcac
tga

DBGET integrated database retrieval system