KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405358Help
Entry
100405358         CDS       T03264                                 

Gene name
LIG3
Definition
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03410  Base excision repair
Module
cjc_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    100405358 (LIG3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100405358 (LIG3)
Enzymes [BR:cjc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100405358 (LIG3)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     100405358 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N zf-PARP DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme Synaptonemal_3
Motif
Other DBs
NCBI-GeneID: 100405358
NCBI-ProteinID: XP_002748408
Ensembl: ENSCJAG00000014668
LinkDB All DBs
Position
5
AA seq 954 aa AA seqDB search
MSLAFKILFPQTIRALSQKEPCLFRGHHWPDVRQFSQWSETDLLHGQRLFLRRKPILSFQ
ESHLRSRATYLVCLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGICRIG
KVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQH
IADLSSKAASTPKKKAVVQAKLTTTGQVTSPVKGTSFVTSTNPRKFSGFSAKPNTSGEAP
SSPTRKTSLSSSKCDPRHKDCLLREFRKLCAMVADNSSYNTKTQIIQDFLRKGSAGDGFH
GDVYLTVKLLLPGVIKSVYNLNDKQIVKLFSRIFNCNPDEMARDLEQGDVSETIRVFFEQ
SKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDL
KMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLRNEQEVEKKPGQRRALSVQASLMTP
VQPMLAEACKSIEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVVH
FKDYIPQAFPGGQSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYF
NDVSLMDRPLCERRKFLHENMVEIPNRIMFSEMKRVTKASDLADMITRVIREGLEGLVLK
DVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPGS
QKWCTVTKCAGGHDDATLARLQKELDMVKISKDPSKIPSWLKVNKIYYPDFIVPDPKKAA
VWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTV
MAGDEGSSTTGGSSEENKGPSGSSVSHKAPIASPSKPYTSTKKAEGKLSNSNSKSGNMLT
AKSSPVTMGEKLAMKSSPVKVGEKRKAADETLCQTKRRPASEQRGRRTVPAGRR
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtctttggctttcaagatcctctttccacaaaccatccgtgcactcagccaaaaagaa
ccgtgcctattccgaggacatcactggcctgatgtaagacaattcagccagtggtcagaa
acagatctgcttcatggccagcgcctcttcctgagaagaaagcctattctgtcattccag
gaaagccatctaagatcacgtgccacctaccttgtttgcttgccagggttgcatgtggga
ctctgcagtggcccctgtgagatggctgagcaacggttctgtgtggactatgccaagcgt
ggcacagctggctgcaaaaaatgcaaggaaaagattgtgaagggcatatgccgaattggc
aaagtggtaccaaatcccttctcagagtctgggggtgatatgaaagagtggtaccacatt
aaatgcatgtttgagaaactagagcgggcccgggccaccacaaaaaaaatcgaggacctc
acagagctggaaggctgggaggaactggaagataatgagaaggaacagataacccagcac
attgcagatctgtcctctaaggcagcaagtacaccaaagaagaaagctgttgtccaggct
aagttgacaaccactggccaggtgacatctccagtgaaaggcacctcatttgttaccagt
actaatccccggaaattttctggcttttcagccaaacccaacacctctggggaagccccc
tcaagccccacccgtaagacaagtctgtcttcaagcaaatgtgaccccaggcataaggac
tgtctgctacgggagtttcgaaagttgtgcgccatggtggctgataattctagctacaac
accaagacccagatcatccaggacttccttcggaaaggctcagcaggagatggtttccac
ggtgatgtgtacctaacagtgaagctgctgctgccaggagtcattaagagtgtttacaac
ttgaatgataagcagattgtgaagcttttcagtcgcatctttaactgcaacccagatgag
atggcacgggacctagagcagggtgacgtgtcagagacaatcagagtcttctttgagcag
agcaagtcttttcccccagctgccaagagcctccttaccatccaggaagtggatgagttc
cttctgcggctgtccaagctcaccaaggaggatgagcagcaacaggccctgcaggacatt
gcctccaggtgtacagccaatgaccttaaatgcatcatcaggttgatcaaacatgatctg
aagatgaactcaggtgcaaaacatgtgttagacgcccttgaccccaatgcctatgaagcc
ttcaaagcctcgcgcaacctgcaggatgtggtggagcgggtccttcgcaatgagcaggag
gtggagaagaagccaggccagagacgagctctgagcgtccaggcctcactgatgacacct
gtgcagcccatgctggcggaggcctgcaagtccattgagtatgcaatgaagaagtgtccc
aatggcatgttctctgagatcaagtacgatggagagcgagtccaagtgcataagaatggg
gaccacttcagctacttcagccgcagtctcaagcccgtcttgcctcacaaggtggtccac
tttaaggactacatcccccaagcttttcctgggggccaaagcatgatcttggactcggag
gtgcttctgattgacaacaagacagggaagccactgccctttgggactctgggagtgcac
aagaaagcggcctttcaggatgccaatgtctgcctgtttgtttttgattgtatctacttt
aatgatgtcagcttgatggacaggcctctgtgtgagcggcggaagtttcttcatgagaac
atggttgaaattccaaaccggatcatgttctcagaaatgaaacgagtcacaaaagcttcg
gacttggctgacatgataacccgggtgatccgggagggattggaggggctggtgctgaag
gatgtgaagggtacatatgagcctgggaagcggcactggctgaaagtgaagaaagactat
ttgaatgagggggccatggccgacacagctgacctggtggtccttggggccttctatggg
caagggagcaaaggcggcatgatgtcaatcttcctcatgggctgctatgaccctggcagc
cagaagtggtgcacagtcaccaagtgtgcaggaggccatgacgatgccacacttgcccgc
cttcagaaggaactagacatggtgaagatcagcaaggaccccagcaaaatacccagctgg
ctgaaggtcaacaagatctactatcctgacttcatcgtcccagacccaaagaaagctgct
gtgtgggagatcacaggggctgaattctccaaatcggaggctcacacagctgatgggatc
tccatccgattccctcgctgcacccgaatccgagatgataaggactggaaatctgccact
aaccttcctcaactcaaggaactgtaccagctgtccaaggagaaagcagacttcactgta
atggctggagatgaaggaagctctactacagggggtagcagtgaagagaataaaggtccc
tcggggtcttctgtgtcccacaaggctcccatcgcctcccccagcaagccatacaccagt
accaagaaagcagaagggaagctgagtaactccaacagcaaaagcggcaacatgctgact
gcaaagtcttcccctgtgacaatgggagagaagctggccatgaagtcttctccggtgaaa
gtgggggagaagcggaaagctgctgatgagaccctgtgccaaacaaagaggcggccagcc
agcgagcagagaggaaggagaactgtgccagcaggcaggagatag

DBGET integrated database retrieval system