KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406446
Entry
100406446         CDS       T03264                                 

Gene name
FOXO3
Definition
(RefSeq) forkhead box O3
  KO
K09408  forkhead box protein O3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc04062  Chemokine signaling pathway
cjc04068  FoxO signaling pathway
cjc04137  Mitophagy - animal
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04218  Cellular senescence
cjc04722  Neurotrophin signaling pathway
cjc04917  Prolactin signaling pathway
cjc05213  Endometrial cancer
cjc05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100406446 (FOXO3)
   04151 PI3K-Akt signaling pathway
    100406446 (FOXO3)
   04152 AMPK signaling pathway
    100406446 (FOXO3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100406446 (FOXO3)
  09143 Cell growth and death
   04218 Cellular senescence
    100406446 (FOXO3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100406446 (FOXO3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100406446 (FOXO3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100406446 (FOXO3)
  09149 Aging
   04211 Longevity regulating pathway
    100406446 (FOXO3)
   04213 Longevity regulating pathway - multiple species
    100406446 (FOXO3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    100406446 (FOXO3)
   05223 Non-small cell lung cancer
    100406446 (FOXO3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100406446 (FOXO3)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    100406446 (FOXO3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 100406446
NCBI-ProteinID: XP_002746997
Ensembl: ENSCJAG00000005929
UniProt: F7IHR2
LinkDB
Position
4
AA seq 672 aa
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEE
EDDEDDEDGGGRASSAMAIGGGGSGTLASGLLLEDSARLLAPGGQDPGSGPAPVAGALSG
GMQAPLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLS
QIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGG
KSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSSD
ELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVSKP
CTVELPRLTDMTGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGS
GLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSH
SDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQ
GALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLPV
MGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTG
AKQASSQSWVPG
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggcagaggcaccggcctccccggccccgctctctccgcttgaagtggagctggacccg
gagttcgagccccagagccggccgcgttcctgtacgtggcccctgcaaaggccggagctc
caggcgagccctgctaagccctcgggggagacagccgccgactccatgatccccgaagag
gaggacgatgaagacgacgaggatggcgggggccgggccagctcggccatggcgatcggc
ggtggcgggagcggcaccctggcctctgggctgctccttgaggactcggcccggctgctg
gcaccgggagggcaagaccccgggtctgggccagcccctgtggcgggcgcgctaagcggg
gggatgcaggcaccgctgcagcctcagcagccgctgccaccgccgcagccaggggcggct
gggggctccgggcagccgaggaaatgctcgtcgcggcggaacgcctggggaaacctgtcc
tacgcggacctgatcacccgcgccatcgagagctcgccggacaaacggctcactctgtcc
cagatctacgagtggatggtgcgctgcgtgccctacttcaaggataagggcgacagcaac
agctcggccggctggaagaactccatccggcacaacctgtcactgcatagtcgattcatg
cgagtccagaatgagggtactggcaagagctcttggtggatcatcaaccctgacgggggg
aagagcggaaaggccccccggcggcgagcagtctccatggacaacagcaacaagtatacc
aagagccgtggccgcgcagctaagaagaaggcagccctgcagacagcccctgaatcagct
gacgacagtccctcccagctctccaagtggcctggcagccccacgtcacgcagcagtgat
gagctggatgcgtggacggacttccgttcacgcaccaattccaacgccagcacagtcagt
ggccgcctgtcaccaatcatggcaagcacagagttggatgaagtccaagatgacgatgcg
cctctctcacccatgctctacagcagctcagccagcctgtcaccttcagtaagcaagcca
tgcacagtggaactgccacggctgactgatatgacaggcaccatgaatctgaatgatggg
ttgactgaaaacctcatggatgacctgctggataacatcacgctcccgccatcccagcca
tcgcccactggggggctcatgcagcggagctctagcttcccgtacaccaccaagggctca
ggcctgggctccccaaccagctcctttaacagcacggtgtttggaccttcatctctgaac
tcgttgcgccagtctcccatgcagaccatccaagagaacaaaccagctaccttctcttcc
atgtcacactatggtaaccagacactccaagacctgctcacttcggactcacttagccac
agcgatgtcatgatgacacagtcggaccccttgatgtctcaggccagcaccgctgtgtct
gcccagaattcccgccggaacgtgatgcttcgcaatgacccgatgatgtcctttgctgcc
cagcctaaccagggaagtttggtcaatcagaacttgctccaccaccagcaccaaacccag
ggcgctcttggtggcagccgtgccttgtcgaattctgtcagcaacatgggcttgagtgag
tccagcagccttgggtcagccaaacaccagcagcagtctcctgtcagccagtctatgcaa
accctctcggactctctctcaggctcctccttgtactcaactagtgcaaacctgcccgtt
atgggccatgagaagttccccagcgacttggacctggacatgttcaatgggagcttggaa
tgtgacatggagtccattatccgtagtgaactcatggatgctgatgggttggattttaac
tttgattccctcatctccacacagaatgttgttggtttgaacgtggggaacttcactggt
gctaagcaggcctcatctcagagctgggtgccaggctga

DBGET integrated database retrieval system