KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406541Help
Entry
100406541         CDS       T03264                                 

Gene name
CTNND2
Definition
(RefSeq) catenin delta 2
  KO
K23491  catenin delta-2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100406541 (CTNND2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm HEAT_2 HEAT Adaptin_N Atx10homo_assoc
Motif
Other DBs
NCBI-GeneID: 100406541
NCBI-ProteinID: XP_008990489
Ensembl: ENSCJAG00000009238
LinkDB All DBs
Position
2
AA seq 1225 aa AA seqDB search
MFARKPPGAAPLGAMPVPDQPSSASEKTSSLSPGLNTSNGDGSETETTSAILASVKEQEL
QFERLTRELEAERQIVASQLERCKLGSETGSMSSISSAEEQFHWQSQDGQKDIEDELTTG
LELVDSCIRSLQESGILDPQEYSTGERPSLLSQSALQLNSKPEGSFQYPASYHSNQTLAL
GETTPSQLPARGTQARAAGQSFSQVGTHRAGHLAGPEPAPPPPPPPREPFAPILGSAFHL
PDAPPTSAAAALYYSSSTLPAPPRGGSPLAAPHGGSPTKLQRGGSAPEGATYAAPRGSSP
KQSPSRLAKSYSTSSPINIVVSSAGLSPIRVTSPPTVQSTISSSPIHQLSSTIGTYATLS
PTKRLVHASEQYSKHSQELYATATLQRPGSLAAGSRASYSSQHGHLGPELRALQSPEHHI
DPIYEDRVYQKPPMRSLSQSQGDPLPPAHTGTYRTSTAPSSPGVDSVPLQRTGSQHGPQN
AAAATFQRASYAAGPASNYADPYRQLQYCPSVESPYSKSGPALPPEGTLARSPSIDSIQK
DPREFGWRDPELPEVIQMLQHQFPSVQSNAAAYLQHLCFGDNKIKAEIRRQGGIQLLVDL
LDHRMTEVHRSACGALRNLVYGKANDDNKIALKNCGGIPALVRLLRKTTDLEIRELVTGV
LWNLSSCDALKMPIIQDALAVLTNAVIIPHSGWENSPLQDDRKIQLHSSQVLRNATGCLR
NVSSAGEEARRRMRECDGLTDALLYVIQSALGSSEIDSKTVENCVCILRNLSYRLAAETS
QGQHMGTDELDGLLCGEANGKDAESSGCWGKKKKKKKSQDQWDGVGPLPDCAEPPKGIQM
LWHPSIVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKWSVYIRAAVRKEKGLPILVEL
LRIDNDRVVCAVATALRNMALDVRNKELIGKYAMRDLVHRLPGGNNSNSTASKAMSDDTV
TAVCCTLHEVITKNMENAKALRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYR
DLRSLYKKDGWSQYHFVASSSTIERDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREM
ISLKERKTDYECTGSNAAYHGAKGEHTSRKDAMTAQNTGISTLYRNSYGAPTEDTKHNQV
SAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLGLKSTGNYVDF
YSAARPYSELNYETSHYPASPDSWV
NT seq 3678 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgaggaagccgccgggcgccgcgccgttgggagctatgcctgtcccagaccag
ccttcatcagcctcagagaagacgagttccctgagccccggcttaaacacctccaacggg
gatggatctgaaacagaaaccacctctgccatccttgcctcagtcaaagaacaggaatta
cagtttgaaaggctgacccgagagctggaggctgaacggcagatcgtagccagccagctg
gagcgatgcaagctggggtccgagaccggcagcatgagcagcatcagttcagcagaagag
cagtttcactggcagtcacaagatggtcaaaaagatatcgaagatgagcttacaacaggt
ctcgagctggtggactcctgtattaggtcactacaggaatcgggaatacttgacccacag
gaatattctacaggtgaaaggcccagcctgctctcccagagtgcacttcagctcaattcc
aaacctgaagggtctttccagtatccagccagctaccatagcaaccagaccctggccctg
ggggaaaccaccccttcacagctcccggcccgaggcacacaagcccgagctgcgggccaa
agcttcagccaggtaggtacccaccgcgccggccacctggcggggccggagcccgcgccg
ccgccaccgccgccgccgcgggagccgttcgcgcccatcctgggcagcgccttccacctg
cccgacgcgccgcccacctccgccgccgccgctctctactactccagctccacgctgccc
gcgccgccgcgcgggggctccccgctggccgcgccccatggcggctcgcccaccaagctg
cagcgcggaggctcggcccccgagggcgccacctacgccgcgccgcgcggctcctcgccc
aagcagtcgcccagccgcctggccaagtcctacagcaccagctcgcccatcaacatcgtc
gtgtcctcggccggcctgtccccgatccgcgtgacctcgccccccaccgtgcagtccacc
atctcctcctcgcccatccaccagctgagctccaccatcggcacgtacgccaccctgtcg
cccaccaagcgcctggtccacgcgtccgagcagtacagcaagcactcgcaggagctgtat
gccacggccaccctccagaggccgggcagcctggcagctgggtcccgagcctcatacagc
agccagcatgggcacctgggcccagagctgcgggccctgcagtccccagaacatcacata
gatcccatctacgaagaccgtgtctatcagaagccccctatgaggagtctcagccagagc
cagggggaccctctgccgccagcacacactggcacctaccgcacgagcacagccccatct
tcccctggtgtcgactccgtccccttgcagcgcacaggcagccagcatggcccgcagaat
gccgccgcggccaccttccagagggccagctatgccgcaggcccggcctccaattacgcg
gacccctaccgacagctgcagtattgtccctctgttgagtctccgtacagcaaatccggc
cctgctctcccacccgaaggcaccttggccaggtccccgtccattgatagcattcagaaa
gatcccagagaatttggatggagagacccggaactgccggaagtgattcagatgttgcaa
caccagtttccctccgtccagtccaatgcggcagcctacttgcagcacctctgctttgga
gacaacaaaattaaagccgagataagaagacaaggaggcatccagctcttggtggacctg
ttggatcatcggatgactgaagtccaccgtagcgcctgtggagctctgagaaacctggtg
tatggaaaggccaatgatgataacaaaattgccctgaaaaactgtggcggcatcccagcg
ctggtgcggttactccgcaagaccaccgacctggagatccgggagctggtcacaggagtc
ctctggaacctctcctcatgtgatgcactcaaaatgccaatcatccaggatgccctggca
gtactgaccaacgcagtgattatccctcactcaggctgggaaaattcgcctcttcaggat
gatcggaaaatacagctgcattcatcacaggtgctgcgtaacgccaccgggtgcctaagg
aatgttagttcggccggagaggaggctcgcagaaggatgcgagagtgtgatgggctcaca
gatgccttgctgtacgtgatccagtctgcactggggagcagtgagatcgatagcaagacc
gttgaaaactgtgtgtgcattttaagaaacctctcgtaccggctggcggcagaaacgtct
cagggacagcacatgggcacggatgagctggacgggctactctgtggcgaggccaatggc
aaggacgcagagagctctggttgctggggcaagaagaagaagaaaaagaaatcccaagat
cagtgggatggagtaggacctcttccagactgtgctgaaccaccaaaagggatccagatg
ctgtggcacccatcaatagtcaaaccctacctcacactgctctctgagtgctcaaatcca
gacacgctggaaggggcggcaggcgccctgcagaacttggctgcagggagctggaagtgg
tcagtttatatccgagctgctgtccgaaaagagaaaggcctgcccatcctcgtggagctg
ctccggatagacaatgaccgcgtggtgtgcgcggtggccacggcactgcggaacatggcc
ttggatgtgagaaataaggagctcattggcaaatatgccatgcgagacctagtccacaga
cttccaggtgggaacaacagcaacagcacggcaagcaaggccatgtcggatgacacagtg
acagccgtctgctgcaccctgcacgaagttattaccaagaacatggagaacgccaaggcc
ttacgggatgctggtggcatcgagaagttggtcggcatctccaaaagcaaaggagataaa
cactctccaaaagtggtcaaggccgcatctcaggtcctcaacagcatgtggcagtaccga
gatctgaggagtctctacaaaaaggatggatggtcacaataccacttcgtagcctcgtct
tcaaccattgagagggaccggcaaaggccctactcctcctcccgcacgccctccatctcc
cctgtgcgcgtgtctcccaacaaccgctcagcaagtgccccagcttcacctcgggaaatg
atcagcctcaaggaaaggaaaacagactacgagtgcaccggcagcaatgccgcctaccat
ggggcgaaaggcgaacacacttccaggaaagatgccatgacagctcaaaacactggaatt
tcaactttgtacaggaattcatatggtgcgcccactgaagacaccaaacacaaccaggtt
tcagcacagccagtcccacaggagcccagcagaaaagattatgagacctaccagccgttt
cagaattccacgagaaattacgacgagtccttcttcgaggaccaggtccaccatcgccct
cccgccagcgagtacaccatgcacctggggctcaagtccaccggcaactacgttgacttc
tactcagctgcccgtccctacagtgaactgaactatgaaacgagccactacccggcctcc
cccgactcgtgggtgtga

DBGET integrated database retrieval system