KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406548Help
Entry
100406548         CDS       T03264                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04020  Calcium signaling pathway
cjc04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100406548 (CACNA1E)
   04020 Calcium signaling pathway
    100406548 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100406548 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100406548 (CACNA1E)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100406548 (CACNA1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 100406548
NCBI-ProteinID: XP_002807751
Ensembl: ENSCJAG00000004426
LinkDB All DBs
Position
18
AA seq 2460 aa AA seqDB search
MLPEMRGLSPDRRLPEPALCPAAGSPEPVAAGRRRRHVLALPEEEAWRPQQCTLLEAEAS
EEVGMLPASPRAASGFGFDNFFPVQEGEGPGWEGAVALEAGSSPFLPVSPEVMKRRRGGL
IEQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVVARPGSGDGDSDQSRNRQGTPVPAS
GQAAAYKQTKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEY
MILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKG
SYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKS
IMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFMNNSGILEGFDPPHPCGVQGC
PAGYECKDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIP
LIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEV
MLAEENKNAGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSTKVD
GVSYFRHKERLLRISIRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYAEF
LFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRA
LRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFND
GTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYT
LLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRR
HHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRKHMQMSSQEALNREEAPPMNPLNPLNP
LSPLNPLNAHPSLYRRPRAIEGLALGLALEKFDEERISRGGSLKGEGGDRSSTLDNQRTP
LSLGQRELPWLPRSCHGNCDPTQQEAGGGEAVVTFEDRARHRQSQRRSRHRRVRTEGKES
SSASRSRSASQERSLDEAVPAEGEKEHELRGNHSAKEPTIQEERAQDLRRTNSLMLSRGS
GLAGALDEANTPLVLPHPELEVGKDAVLTEQEPEGSSEQALLGDVQLDMGRVISHSEPDL
SCITANTDKAITESTSVTVAIPDVGPLVDSTVVHISNKTDGEASPLKEAEIRDDEEEVEN
KKQKKEKRETGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAE
DPVLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGA
LVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNIL
IVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEF
HYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFF
FVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWH
FVVSPSFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKVIAFG
FLNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTI
RILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSL
MLLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFL
MLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSP
PLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDS
ELQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQ
KNAPMFQRMEPSSLPQEIIANAKALPYLQQEHNSGLSGRTGYPSMSPLSPQEIFQLACMD
PADDGQFQEQQSLEPEVSEFKSVQPANHGIYLPSDTQEHAGSGRASSMPRLTVDPQVVTD
PSSMRRSFSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKS
DTHRSGGRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERRQSRSPSEGRSQTPNQQ
GTGSLSESSIPSVSDTSTPRRSRRQLPPVPPKPRPLLSYSSLIRHAGSISPPADGSQEGS
PLTSQALESNNACLTESSNSPHPQQGQHISPQRYISEPYLAQHEDSHASDCGEEETLTFE
AAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGSGMMCGAVNNLLSDTEEDDKC
NT seq 7383 nt NT seq  +upstreamnt  +downstreamnt
atgctgccggagatgcgtggactgagcccagaccgcaggctgcccgagcccgccctctgc
ccggctgcagggagccctgagcccgtggccgcgggccgccgccgacgccacgtgctggcc
ctgccagaggaggaggcatggcggccccagcaatgcaccctgctcgaggccgaggcctca
gaagaggtgggcatgctgccagcctccccacgtgccgcctccggcttcggcttcgacaac
ttcttcccggtgcaggagggcgagggcccgggctgggagggcgctgtggcgctggaggcg
ggctccagccccttcctcccggtgagccccgaggtcatgaagcggcggcgcgggggcctc
atcgagcagcgggacatcatcaaggcccacgaggcacacaagatgcagagcactccgcag
gcccggcggaaggaatgggagatggctcgcttcggggaggcggtggtcgccaggccgggg
tcgggcgatggagactcggaccagagcaggaaccggcaaggaacccccgtgccggcctcg
gggcaggcggccgcctacaagcagacgaaagcgcagagggcgcggactatggctttgtac
aaccccattcccgtccggcagaactgtttcaccgtcaacagatccctgttcatcttcgga
gaagataacattgtcaggaaatatgccaagaagctcatcgattggccgccgtttgagtac
atgattctggccaccatcatcgccaactgcatagtcctcgctctggagcagcatcttcct
gaggatgacaagacccccatgtcccgaagactggagaagacagaaccttatttcattggg
atattttgctttgaagctgggatcaaaattgtagccttggggttcatcttccataagggc
tcgtacctgcgcaatggctggaatgtcatggacttcattgtggtcctcagtggcatcctg
gccactgcgggaacccacttcaacactcatgtggacctgaggaccctccgggctgtgcgt
gtcctgcggcccttgaagctcgtgtcagggatacctagcctgcagattgtgttgaagtcc
atcatgaaggccatggtccctcttctgcagattggccttctgctcttctttgccatcctg
atgttcgctatcatcggcctggagttctacagcgggaagttacaccgagcatgcttcatg
aacaattcaggtattctagaaggatttgacccccctcacccgtgtggcgtgcagggctgc
cctgctggttatgaatgcaaggactggattggccccaatgatgggatcacccagtttgat
aacatcctctttgctgtgctgactgtcttccagtgcatcaccatggaagggtggaccacc
gtgctgtacaataccaatgatgccttaggagccacctggaattggctgtacttcatcccc
ctcatcatcatcggatccttctttgttctcaacctagtcctgggagtgctttccggggaa
tttgccaaagagagagagagagtggaaaaccgaagggctttcatgaagctgcggcgccag
cagcagattgagcgggagctgaatggctaccgggcctggatagacaaagcagaggaagtc
atgctcgctgaagaaaataaaaatgctggaacatccgccttagaagtgcttcgaagggca
accatcaaaaggagccggacagaggccatgacccgagactccagtgatgagcactgtgtt
gatatctcctctgtgggcacacctttggctcgagccagtatcaaaagtacaaaggtagat
ggggtctcttatttccggcacaaggaaaggcttctgcgcatctccattcgccacatggtt
aaatcccaggtgttttactggattgtgctgagccttgtggcactcaacactgcctgtgtg
gccatcgtccatcacaaccagccccagtggctcacccacctcctctactatgcagaattt
ctgtttctgggactcttcctcttggagatgtccctgaagatgtatggcatggggcctcgc
ctttattttcactcttcattcaactgctttgattttggggtcacagtgggcagtatcttt
gaagtggtctgggcaatcttcagacctggtacatcttttggaatcagtgtcttgcgagcc
ctccggcttctaagaatatttaaaataaccaagtattgggcttccctacggaatttggtg
gtctccttgatgagctccatgaagtctatcatcagtttacttttcctcctcttcctcttc
atcgttgtctttgctctcctgggaatgcagttatttggaggcaggtttaactttaatgat
gggactccttcagcaaactttgacaccttccctgcagccatcatgaccgtgttccagatc
ctgacaggtgaggactggaacgaggtgatgtacaatgggatccgctcccagggcggggtc
agctcaggcatgtggtctgccatctacttcattgtgctcaccttgtttggcaactacacg
ctactgaatgtgttcttggctatcgctgtggataatctggccaacgcccaggagctgacc
aaggatgaacaggaggaagaagaggccttcaaccagaaacatgcactgcagaaggccaag
gaggtcagcccgatgtctgcacccaacatgccttcgatcgaaagagacagaaggagaaga
caccacatgtcgatgtgggagccacgcagcagccacctgagggagcggaggcgccggcac
cacatgtcggtgtgggagcagcgcaccagccagctgaggaagcatatgcagatgtccagc
caggaggccctcaacagggaagaggcgccgcccatgaacccgctcaaccccctcaatcca
ctcagccccctcaacccactcaacgcccaccccagcctttatcggagacccagggccatc
gagggcctggccctgggcctggccctggagaagttcgatgaggagcgcatcagccgtggc
gggtccctcaagggggagggaggggaccgatccagtaccctggacaaccagaggaccccc
ttgtccctgggccagcgggagctgccatggctgcccaggtcctgtcatgggaactgtgac
ccgactcagcaggaggctgggggaggagaggctgtggtgacctttgaggaccgggccagg
cacaggcagagccagcggcgcagccggcatcgccgcgtcaggacggaaggcaaggagtcc
tcctcagcctcccggagcaggtctgccagccaggaacgcagtctggatgaagccgtgccc
gctgaaggggagaaggagcacgagctgaggggcaaccacagtgccaaggaaccgacgatc
caagaagagagagctcaggatttaaggaggaccaacagtctgatgttgtccaggggctct
gggctggcaggagcccttgatgaggcaaacacccccctagtcctgccccatcctgagctg
gaagtggggaaggacgcggtgctgacagagcaggagcccgaaggcagcagtgaacaggcc
ctgcttggggacgtacagctagacatgggccgggttatcagccacagcgagcccgacctc
tcctgcatcacggccaacacggacaaggccatcaccgagagcaccagtgtcaccgtcgcc
atccctgatgtgggccccttggtggactcaaccgtggtgcacattagcaacaagacggat
ggggaagccagccccttgaaggaggcagagatcagagatgatgaggaggaggtggagaac
aagaagcagaagaaggagaaacgtgagacgggcaaagccatggtgccccacagctccatg
ttcatcttcagcaccaccaacccgatccggagggcctgccactacatagtgaacctgcgc
tactttgagatgtgcatcctcctggtgatcgcggccagcagcatcgccctggcggcagag
gaccctgtcctgaccaactcggagcgcaacaaagtcctgcggtattttgactatgtgttc
acgggcgtgttcacctttgagatggttataaagatgatagaccaaggcttgatcctgcaa
gacgggtcctacttccgagacctgtggaacatactggactttgtggtggtagttggcgca
ttggtggcctttgctctggcgaacgctttgggaaccaacaaaggacgggacatcaagacc
atcaagtctctgcgggtgctccgagttctaaggccactgaaaaccatcaagcgtttgccc
aagctcaaggccgtcttcgactgcgtggtgacctccttgaagaatgtcttcaacatcctc
attgtctacaagctcttcatgttcatctttgctgtcatcgcagtccagctcttcaaggga
aagttcttttattgcacggacagttccaaggacacagagaaggagtgcataggcaactac
gtagatcatgagaaaaataagatggaggtgaagggccgggaatggaagcgccacgaattc
cactatgacaacatcatctgggccctgctgaccctcttcaccgtctccacgggggaagga
tggcctcaagttctgcagcactccgtagatgtgacggaggaagaccgaggcccgagccgc
agcaaccgcatggagatgtccatcttttatgtggtctactttgtggtcttccctttcttc
tttgtcaatatctttgtggctctcatcatcatcaccttccaggagcaaggggataagatg
atggaggagtgcagcctggagaagaacgagagggcgtgcatcgacttcgccatcagtgcc
aaacctctcacccgctacatgccgcagaacaggcacaccttccagtaccgcgtgtggcac
tttgtggtgtctccgtccttcgagtacaccattatggccatgatcgctttgaacactgtc
gtgctgatgatgaagtattactctgctccttgtacctatgagctggccctgaagtacctg
aatattgccttcaccatggtgttttccctggaatgcgtcctgaaggtcattgcttttggc
tttttgaactatttccgagacacctggaatatcttcgacttcatcaccgtgattggcagt
atcacagaaattatcctgacagacagcaagctggtgaacaccagtggcttcaatatgagt
tttctgaagctcttccgagcagctcgcctcataaagctcctgcgtcagggctataccata
cgcattttgctgtggacctttgtgcagtcctttaaggccctcccttatgtctgcctttta
attgctatgcttttcttcatttatgccatcattgggatgcaggtatttggaaacataaaa
ttagatgaggagagtcacatcaaccggcacaacaacttccggagtttctttgggtcccta
atgctactgttcaggagcgccacaggtgaggcctggcaggagatcatgctgtcctgcctt
ggggagaagggctgtgagcctgacaccaccgcaccatcagggcagaacgagaacgagcgc
tgtggcaccgatctggcctacgtgtactttgtctccttcatcttcttctgctccttcttg
atgctcaacctattcgtggccgtcatcatggacaactttgagtacctgactcgggactcc
tccatcctggggcctcaccacttggatgagttcgtccgcgtctgggcagaatatgaccga
gcagcatgtggccgcatccattacactgagatgtatgaaatgctgactctcatgtcacct
ccgctaggcctcggcaagagatgtccctccaaagtggcatataagaggctggtcctgatg
aacatgccagtagctgaggacatgacagttcacttcacctccacgcttatggctctgatc
cggacagctctggacattaaaattgccaaaggtggtgcagataggcagcagctagactca
gagctacagaaggagaccctagccatctggcctcacctatcccagaagatgctggatctg
cttgtgcccatgcccaaagcctctgacctgactgtgggcaaaatctatgcagcaatgatg
atcatggactactataagcagagtaaggtgaagaagcagaggcagcagctggaggaacag
aaaaatgcccccatgttccagcgcatggagccctcatctctgcctcaggagattattgct
aatgccaaagccctgccttacctccagcaggaacacaattctggactgagtggcaggact
ggatatccttcgatgagtccactttctccccaggagatattccagttggcttgtatggac
cctgccgatgatggacagttccaggaacagcagtctctggagccagaggttagtgaattt
aaaagcgtgcagcccgctaaccatggcatctaccttccttcggacacccaggagcatgcg
ggatctgggagggcgtcttctatgccacgtctgactgtggatccccaggtggtgacagac
cctagctccatgagacgttccttttccactattcgggataagcgttcaaattcctcgtgg
ttggaggaattctccatggagcgaagcagtgaaaatacctacaagtcccgtcgccggagt
taccactcctccctgcggctgtcagcccaccgcctgaactctgattcaggccataagtct
gacactcaccgctcagggggcagggagaggggacgatcaaaagagcgaaagcatcttctt
tctcctgatgtctcccgctgcaattcagaggagcgagggacccaggctgactgggagtcc
ccagagcgccgtcaatccaggtcacccagtgagggcaggtcacagacgcccaaccaacag
ggcacaggttccctaagtgagagctccatcccctctgtctctgacaccagcactccaaga
agaagtcgcaggcagctcccgcccgtcccaccaaagccccggcccctcctttcctacagc
tccctgattcgacatgctggcagcatctctccgcctgctgatggaagccaggagggctcc
ccgctgacctcccaagccctggagagcaacaacgcttgcctgaccgagtcttctaactcc
ccgcacccccagcagggccaacacatctccccacagcgctacatctctgagccctacttg
gcccagcatgaagactcccacgcttcagactgtggcgaggaggagacgctcactttcgaa
gcagctgtggctactagcctgggccgttccaacaccatcggctctgccccacccctgcgg
cacagctggcagatgcccaacgggcactatcggcggcggaggcgcggggggcctgggtca
ggcatgatgtgtggggctgtcaacaacctgctgagtgacacggaagaagacgacaaatgc
tag

DBGET integrated database retrieval system