KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406564
Entry
100406564         CDS       T03264                                 

Gene name
RUNX2
Definition
(RefSeq) runt related transcription factor 2
  KO
K09278  runt-related transcription factor 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100406564 (RUNX2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100406564 (RUNX2)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    100406564 (RUNX2)
SSDB
Motif
Pfam: Runt RunxI
Other DBs
NCBI-GeneID: 100406564
NCBI-ProteinID: XP_008992772
Ensembl: ENSCJAG00000012153
LinkDB
Position
4
AA seq 398 aa
MVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGND
ENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTV
DGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQG
QSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISG
ASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLP
PPYPGSSQSQSGPFQTSSTPYLYYGTSSGSYQFPMVPGGDRSPSRMLPPCTTTSNGSTLL
NPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggtggagatcatcgccgaccacccggccgagctcgttcgcaccgacagccccaacttc
ctgtgctcggtgctgccctcgcactggcgctgcaacaagaccctgcccgtggctttcaag
gtggtagccctcggagaggtaccagatgggactgtggttactgtcatggcgggtaatgat
gaaaattattctgctgagctccggaatgcctctgctgttatgaaaaaccaagtagcaagg
ttcaacgatctgagatttgtgggccggagtggacgaggcaagagtttcaccttgaccata
accgtcttcacaaatcctccccaagtagctacctatcacagagcaattaaagttacagtg
gatggacctcgggaacccagaaggcacagacagaagcttgatgactctaaacctagtttg
ttctctgaccgcctcagtgatttagggcgcattcctcatcccagtatgagagtaggtgtc
ccgcctcagaacccacggccctccctgaactctgcaccaagtccttttaatccacaagga
cagagtcagattacagaccccaggcaggcacagtcttccccgccgtggtcctatgaccag
tcttacccctcctacctgagccagatgacgtccccgtccatccactctaccaccccgctg
tcttccacacggggcactgggcttcccgccatcaccgatgtgcctaggcgcatttcaggt
gcttcagaactgggccctttttcagaccccaggcagttcccaagcatttcatccctcact
gagagccgcttctccaacccacgaatgcactatccagccacctttacttacaccccgcca
gtcacctcaggcatgtccctcggtatgtccgccaccactcactaccacacctacctgcca
ccaccctatcccggctcttcccaaagccagagtggacccttccagaccagcagcactcca
tatctctactatggcacttcgtcaggatcctatcagtttcccatggtgccggggggagac
cggtctccttccagaatgcttccgccatgcaccaccacctcgaatggcagcacgctatta
aatccaaatttgcctaaccagaatgatggtgttgacgctgatggaagccacagcagttcc
ccaactgttttgaattctagtggcagaatggatgaatctgtttggcgaccatattga

DBGET integrated database retrieval system